Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | shpAB/BrnT-BrnA |
| Location | 2000492..2001068 | Replicon | chromosome |
| Accession | NZ_CP109692 | ||
| Organism | Enterobacter asburiae strain 2017-45-80 | ||
Toxin (Protein)
| Gene name | shpA | Uniprot ID | A0A4R0G892 |
| Locus tag | OI907_RS10030 | Protein ID | WP_010427219.1 |
| Coordinates | 2000781..2001068 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | shpB | Uniprot ID | A0A411GC49 |
| Locus tag | OI907_RS10025 | Protein ID | WP_033144548.1 |
| Coordinates | 2000492..2000794 (-) | Length | 101 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OI907_RS10000 (OI907_09985) | 1996598..1997143 | + | 546 | WP_023310269.1 | YfaZ family outer membrane protein | - |
| OI907_RS10005 (OI907_09990) | 1997143..1997463 | + | 321 | WP_033144551.1 | hypothetical protein | - |
| OI907_RS10010 (OI907_09995) | 1997510..1998880 | - | 1371 | WP_033144550.1 | NAD-dependent succinate-semialdehyde dehydrogenase | - |
| OI907_RS10015 (OI907_10000) | 1999032..1999775 | + | 744 | WP_033146481.1 | AraC family transcriptional regulator | - |
| OI907_RS10020 (OI907_10005) | 1999823..2000461 | + | 639 | WP_033144549.1 | LysE family translocator | - |
| OI907_RS10025 (OI907_10010) | 2000492..2000794 | - | 303 | WP_033144548.1 | BrnA antitoxin family protein | Antitoxin |
| OI907_RS10030 (OI907_10015) | 2000781..2001068 | - | 288 | WP_010427219.1 | BrnT family toxin | Toxin |
| OI907_RS10035 (OI907_10020) | 2001239..2002510 | + | 1272 | WP_033144547.1 | DUF445 domain-containing protein | - |
| OI907_RS10040 (OI907_10025) | 2002507..2003583 | - | 1077 | WP_023310256.1 | DUF2955 domain-containing protein | - |
| OI907_RS10045 (OI907_10030) | 2003573..2004640 | - | 1068 | WP_101744430.1 | HlyD family secretion protein | - |
| OI907_RS10050 (OI907_10035) | 2004637..2005107 | - | 471 | WP_033144545.1 | MarR family transcriptional regulator | - |
| OI907_RS10055 (OI907_10040) | 2005257..2005952 | - | 696 | WP_033144544.1 | winged helix-turn-helix domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11174.64 Da Isoelectric Point: 6.7609
>T261981 WP_010427219.1 NZ_CP109692:c2001068-2000781 [Enterobacter asburiae]
MPTEFEWDTNKAKSNLIKHGIRFEEAVLVFDDPYHLSLQDRHENGEFRWQTIGLVHGLIVIMVAHTVRFESGDEVIRIIS
ARKADRKERSRYEHG
MPTEFEWDTNKAKSNLIKHGIRFEEAVLVFDDPYHLSLQDRHENGEFRWQTIGLVHGLIVIMVAHTVRFESGDEVIRIIS
ARKADRKERSRYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A4R0G892 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A411GC49 |