Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) parDE/ParE-RHH
Location 46408..46927 Replicon plasmid p2017-45-80_2
Accession NZ_CP109691
Organism Enterobacter asburiae strain 2017-45-80

Toxin (Protein)


Gene name parE Uniprot ID A0A9E7BHM1
Locus tag OI907_RS00290 Protein ID WP_047389778.1
Coordinates 46643..46927 (+) Length 95 a.a.

Antitoxin (Protein)


Gene name parD Uniprot ID A0A9E7BH21
Locus tag OI907_RS00285 Protein ID WP_047389775.1
Coordinates 46408..46650 (+) Length 81 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OI907_RS00270 (OI907_00270) 42900..43904 + 1005 WP_000427623.1 IS110-like element IS4321 family transposase -
OI907_RS00275 44824..44919 + 96 WP_000609145.1 DinQ-like type I toxin DqlB -
OI907_RS00280 (OI907_00275) 45105..45347 - 243 WP_052132603.1 hypothetical protein -
OI907_RS00285 (OI907_00280) 46408..46650 + 243 WP_047389775.1 type II toxin-antitoxin system ParD family antitoxin Antitoxin
OI907_RS00290 (OI907_00285) 46643..46927 + 285 WP_047389778.1 type II toxin-antitoxin system RelE/ParE family toxin Toxin
OI907_RS00295 (OI907_00290) 47059..47286 - 228 WP_047389780.1 plasmid partition protein ParG -
OI907_RS00300 (OI907_00295) 47325..47945 - 621 WP_047389782.1 ParA family partition ATPase -
OI907_RS00305 (OI907_00300) 48898..49416 + 519 WP_003464991.1 DUF417 family protein -
OI907_RS00310 (OI907_00305) 49446..49586 - 141 Protein_61 helix-turn-helix domain-containing protein -
OI907_RS00315 (OI907_00310) 49650..50354 + 705 WP_047389788.1 IS6-like element IS26 family transposase -
OI907_RS00320 (OI907_00315) 50497..51144 - 648 WP_024262784.1 recombinase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Non-Mobilizable plasmid - - 1..62976 62976
- flank IS/Tn - - 49650..50354 704


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin-antitoxin system, RelE/ParE toxin family

(2-88)

Antitoxin

Antitoxin ParD

(1-64)


Sequences

Toxin        


Download         Length: 95 a.a.        Molecular weight: 10965.46 Da        Isoelectric Point: 6.2103

>T261978 WP_047389778.1 NZ_CP109691:46643-46927 [Enterobacter asburiae]
VYKLTERAADDFAGIYDYTLLKFGEAQADHYTDALEAFFETLAGMPDMGRDYHAVSGVMRIEFQRHAIFYTVRDTDILIA
RILHQQMNHKRHLL

Download         Length: 285 bp

Antitoxin


Download         Length: 81 a.a.        Molecular weight: 8949.09 Da        Isoelectric Point: 7.0142

>AT261978 WP_047389775.1 NZ_CP109691:46408-46650 [Enterobacter asburiae]
MARTTSVTIGEQLDSFISRLIDSGRYGSASEVMRSALRLLEQQETNDEVVRQAVITGLESGESSLSLRDIAEKRKLRHRV

Download         Length: 243 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure

Antitoxin

Source ID Structure

References