Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/ElaA-DUF1778 |
Location | 31270..32009 | Replicon | plasmid p2017-45-80_2 |
Accession | NZ_CP109691 | ||
Organism | Enterobacter asburiae strain 2017-45-80 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A9E6WPH7 |
Locus tag | OI907_RS00200 | Protein ID | WP_013087269.1 |
Coordinates | 31524..32009 (+) | Length | 162 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | A0A9E6WPN8 |
Locus tag | OI907_RS00195 | Protein ID | WP_007869691.1 |
Coordinates | 31270..31536 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OI907_RS00185 (OI907_00185) | 26862..29759 | + | 2898 | WP_004206881.1 | Tn3-like element Tn5403 family transposase | - |
OI907_RS00190 (OI907_00190) | 29793..30602 | - | 810 | Protein_37 | plasmid replication initiator RepA | - |
OI907_RS00195 (OI907_00195) | 31270..31536 | + | 267 | WP_007869691.1 | DUF1778 domain-containing protein | Antitoxin |
OI907_RS00200 (OI907_00200) | 31524..32009 | + | 486 | WP_013087269.1 | GNAT family N-acetyltransferase | Toxin |
OI907_RS00205 (OI907_00205) | 32210..32821 | - | 612 | WP_223998213.1 | hypothetical protein | - |
OI907_RS00210 (OI907_00210) | 32834..33244 | - | 411 | WP_023327703.1 | hypothetical protein | - |
OI907_RS00215 (OI907_00215) | 33447..34716 | - | 1270 | Protein_42 | type II toxin-antitoxin system HipA family toxin | - |
OI907_RS00220 (OI907_00220) | 34721..35014 | - | 294 | WP_032636197.1 | helix-turn-helix transcriptional regulator | - |
OI907_RS00225 (OI907_00225) | 35579..36583 | - | 1005 | WP_000427623.1 | IS110-like element IS4321 family transposase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..62976 | 62976 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 162 a.a. Molecular weight: 17736.45 Da Isoelectric Point: 9.5181
>T261977 WP_013087269.1 NZ_CP109691:31524-32009 [Enterobacter asburiae]
VGRVTAPEPLSSSHQLAEFVSGEAVLDDWLKQRGLKNQALGAARTFVVCKRDTKQVVGFYSLATGSVNHVEAMGSLRRNM
PDPIPVIILARLAVDVSYRGQGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYLHHGFKASQTQERTLFLKLP
Q
VGRVTAPEPLSSSHQLAEFVSGEAVLDDWLKQRGLKNQALGAARTFVVCKRDTKQVVGFYSLATGSVNHVEAMGSLRRNM
PDPIPVIILARLAVDVSYRGQGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYLHHGFKASQTQERTLFLKLP
Q
Download Length: 486 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|