Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/RelE-RelB |
| Location | 4865360..4865933 | Replicon | chromosome |
| Accession | NZ_CP109657 | ||
| Organism | Pseudomonas aeruginosa strain Zw26 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | - |
| Locus tag | OBG92_RS23040 | Protein ID | WP_264315568.1 |
| Coordinates | 4865360..4865647 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | W5ISI7 |
| Locus tag | OBG92_RS23045 | Protein ID | WP_009618210.1 |
| Coordinates | 4865634..4865933 (-) | Length | 100 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OBG92_RS23015 (OBG92_04529) | 4860991..4863021 | - | 2031 | WP_264315563.1 | DNA topoisomerase III | - |
| OBG92_RS23020 (OBG92_04530) | 4863317..4863700 | - | 384 | WP_264315564.1 | single-stranded DNA-binding protein | - |
| OBG92_RS23025 (OBG92_04531) | 4863697..4864245 | - | 549 | WP_264315565.1 | DUF3158 family protein | - |
| OBG92_RS23030 (OBG92_04532) | 4864242..4865021 | - | 780 | WP_264315566.1 | TIGR03761 family integrating conjugative element protein | - |
| OBG92_RS23035 (OBG92_04533) | 4865141..4865275 | - | 135 | WP_264315567.1 | hypothetical protein | - |
| OBG92_RS23040 (OBG92_04534) | 4865360..4865647 | - | 288 | WP_264315568.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OBG92_RS23045 (OBG92_04535) | 4865634..4865933 | - | 300 | WP_009618210.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| OBG92_RS23050 (OBG92_04536) | 4866061..4867254 | - | 1194 | WP_264315569.1 | STY4528 family pathogenicity island replication protein | - |
| OBG92_RS23055 (OBG92_04537) | 4867257..4867817 | - | 561 | WP_150554693.1 | DUF2857 domain-containing protein | - |
| OBG92_RS23060 (OBG92_04538) | 4867835..4869493 | - | 1659 | WP_264315570.1 | ParB family protein | - |
| OBG92_RS23065 (OBG92_04539) | 4869486..4869734 | - | 249 | WP_264315571.1 | type II toxin-antitoxin system HicA family toxin | - |
| OBG92_RS23070 (OBG92_04540) | 4869718..4870584 | - | 867 | WP_264315572.1 | ParA family protein | - |
| OBG92_RS23075 (OBG92_04541) | 4870626..4870844 | - | 219 | WP_009461157.1 | AlpA family transcriptional regulator | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 10824.37 Da Isoelectric Point: 8.4628
>T261974 WP_264315568.1 NZ_CP109657:c4865647-4865360 [Pseudomonas aeruginosa]
VRVLEWREAARADLLAIVDYISDDNPDAAQRLKDDIEAKAAKLPERPKLYRPGRVAGTREMVVRSNYVVVYVEDSRAVSI
LRVLHAAQQWPPARE
VRVLEWREAARADLLAIVDYISDDNPDAAQRLKDDIEAKAAKLPERPKLYRPGRVAGTREMVVRSNYVVVYVEDSRAVSI
LRVLHAAQQWPPARE
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|