Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 4657791..4658448 | Replicon | chromosome |
| Accession | NZ_CP109657 | ||
| Organism | Pseudomonas aeruginosa strain Zw26 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A0A8G3IXE4 |
| Locus tag | OBG92_RS21890 | Protein ID | WP_003098540.1 |
| Coordinates | 4657791..4657973 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | - |
| Locus tag | OBG92_RS21895 | Protein ID | WP_003124172.1 |
| Coordinates | 4658020..4658448 (+) | Length | 143 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OBG92_RS21860 (OBG92_04302) | 4654516..4655061 | - | 546 | WP_019486501.1 | terminase small subunit | - |
| OBG92_RS21865 (OBG92_04303) | 4655213..4655956 | - | 744 | WP_031634616.1 | hypothetical protein | - |
| OBG92_RS21870 (OBG92_04304) | 4655953..4656402 | - | 450 | WP_256161596.1 | lysis system i-spanin subunit Rz | - |
| OBG92_RS21875 (OBG92_04305) | 4656420..4656659 | - | 240 | WP_228292605.1 | hypothetical protein | - |
| OBG92_RS21880 (OBG92_04306) | 4656659..4657276 | - | 618 | WP_003124173.1 | glycoside hydrolase family 19 protein | - |
| OBG92_RS21885 (OBG92_04307) | 4657276..4657590 | - | 315 | WP_015649339.1 | phage holin, lambda family | - |
| OBG92_RS21890 (OBG92_04308) | 4657791..4657973 | + | 183 | WP_003098540.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OBG92_RS21895 (OBG92_04309) | 4658020..4658448 | + | 429 | WP_003124172.1 | hypothetical protein | Antitoxin |
| OBG92_RS21900 (OBG92_04310) | 4658747..4659304 | - | 558 | WP_015980945.1 | hypothetical protein | - |
| OBG92_RS21905 (OBG92_04311) | 4659301..4659585 | - | 285 | WP_015980944.1 | hypothetical protein | - |
| OBG92_RS21910 (OBG92_04312) | 4659582..4660271 | - | 690 | WP_264315494.1 | metallophosphoesterase | - |
| OBG92_RS21915 (OBG92_04313) | 4660268..4660639 | - | 372 | WP_023124260.1 | hypothetical protein | - |
| OBG92_RS21920 (OBG92_04314) | 4660636..4662066 | - | 1431 | WP_264315495.1 | replicative DNA helicase | - |
| OBG92_RS21925 (OBG92_04315) | 4662063..4662851 | - | 789 | WP_003123987.1 | ATP-binding protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | - | 4634851..4689796 | 54945 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6746.86 Da Isoelectric Point: 11.0775
>T261973 WP_003098540.1 NZ_CP109657:4657791-4657973 [Pseudomonas aeruginosa]
MKFSEFRRWLKAQGVTFEAGKGSHFKITAPNGKQTTFADHGAKEMPEPTRKAIIKQLGLK
MKFSEFRRWLKAQGVTFEAGKGSHFKITAPNGKQTTFADHGAKEMPEPTRKAIIKQLGLK
Download Length: 183 bp
Antitoxin
Download Length: 143 a.a. Molecular weight: 15770.97 Da Isoelectric Point: 4.6562
>AT261973 WP_003124172.1 NZ_CP109657:4658020-4658448 [Pseudomonas aeruginosa]
MYDYAIRFEQDDSAPGVAVFCRDLPELNSYGDDKAHAISEAVDAIESTLSLYVDQRREIPAASQAQPGERVIHLPAVTVA
KVALWNEMIRRDMRKADLCRLLGIAQIQGDRLVDFLHNTKMEAMENALSALGLRLSVNIEAA
MYDYAIRFEQDDSAPGVAVFCRDLPELNSYGDDKAHAISEAVDAIESTLSLYVDQRREIPAASQAQPGERVIHLPAVTVA
KVALWNEMIRRDMRKADLCRLLGIAQIQGDRLVDFLHNTKMEAMENALSALGLRLSVNIEAA
Download Length: 429 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|