Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | hicAB/HicA-HicB |
| Location | 607266..607880 | Replicon | chromosome |
| Accession | NZ_CP109657 | ||
| Organism | Pseudomonas aeruginosa strain Zw26 | ||
Toxin (Protein)
| Gene name | hicA | Uniprot ID | A6VBH9 |
| Locus tag | OBG92_RS02860 | Protein ID | WP_071534354.1 |
| Coordinates | 607266..607448 (+) | Length | 61 a.a. |
Antitoxin (Protein)
| Gene name | hicB | Uniprot ID | A0A140SDX7 |
| Locus tag | OBG92_RS02865 | Protein ID | WP_012077229.1 |
| Coordinates | 607476..607880 (+) | Length | 135 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OBG92_RS02845 (OBG92_00557) | 603870..604748 | - | 879 | Protein_567 | IS3 family transposase | - |
| OBG92_RS02850 (OBG92_00558) | 604758..606107 | - | 1350 | WP_058146648.1 | IS110 family transposase | - |
| OBG92_RS02855 (OBG92_00559) | 606332..606580 | - | 249 | Protein_569 | transposase | - |
| OBG92_RS02860 (OBG92_00560) | 607266..607448 | + | 183 | WP_071534354.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
| OBG92_RS02865 (OBG92_00561) | 607476..607880 | + | 405 | WP_012077229.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
| OBG92_RS02870 (OBG92_00562) | 607923..608894 | - | 972 | WP_012077228.1 | hypothetical protein | - |
| OBG92_RS02875 (OBG92_00563) | 608879..609577 | - | 699 | WP_033896049.1 | hypothetical protein | - |
| OBG92_RS02880 (OBG92_00564) | 609577..610116 | - | 540 | WP_012074127.1 | hypothetical protein | - |
| OBG92_RS02885 (OBG92_00565) | 610113..611033 | - | 921 | WP_012074128.1 | hypothetical protein | - |
| OBG92_RS02890 (OBG92_00566) | 611030..611740 | - | 711 | WP_012074129.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Prophage | - | lpg2359 | 599400..654775 | 55375 | |
| - | flank | IS/Tn | - | - | 603870..604724 | 854 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 61 a.a. Molecular weight: 6702.74 Da Isoelectric Point: 10.4826
>T261968 WP_071534354.1 NZ_CP109657:607266-607448 [Pseudomonas aeruginosa]
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK
MRSREVIDLLLEDGWYEVAVKGSHHQFKHPSKPGKVTVQHPSSTIPKGTLNNILKQAGLK
Download Length: 183 bp
Antitoxin
Download Length: 135 a.a. Molecular weight: 14670.54 Da Isoelectric Point: 4.4315
>AT261968 WP_012077229.1 NZ_CP109657:607476-607880 [Pseudomonas aeruginosa]
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA
MKFPVVLHKDPDSDYGVTVPDVPGCFSAGATVSEALANVEEALALHFEGLVTDGEELPQPQDVDAHMKNPDFEGGVWAVV
DFDVTPYLGKAVRFNATLPEHLLQRIDERVKVDKRYQSRSGFLATAAMRELSVA
Download Length: 405 bp
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A6VBH9 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A140SDX7 |