Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | parDE/RHH(antitoxin) |
Location | 138851..139356 | Replicon | chromosome |
Accession | NZ_CP109657 | ||
Organism | Pseudomonas aeruginosa strain Zw26 |
Toxin (Protein)
Gene name | parE | Uniprot ID | A0A2R3IRV5 |
Locus tag | OBG92_RS00645 | Protein ID | WP_058145534.1 |
Coordinates | 138851..139132 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | parD | Uniprot ID | A0A4P0TKN5 |
Locus tag | OBG92_RS00650 | Protein ID | WP_034081045.1 |
Coordinates | 139129..139356 (-) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OBG92_RS00620 (OBG92_00121) | 134110..135459 | + | 1350 | WP_023443219.1 | C4-dicarboxylate transporter DctA | - |
OBG92_RS00625 (OBG92_00122) | 135507..136193 | + | 687 | WP_011979163.1 | FadR/GntR family transcriptional regulator | - |
OBG92_RS00630 (OBG92_00123) | 136294..137028 | + | 735 | WP_058145532.1 | GntR family transcriptional regulator | - |
OBG92_RS00635 (OBG92_00124) | 137207..137596 | + | 390 | WP_235582454.1 | aegerolysin family protein | - |
OBG92_RS00640 (OBG92_00125) | 137663..138553 | - | 891 | WP_043099741.1 | LysR family transcriptional regulator | - |
OBG92_RS00645 (OBG92_00126) | 138851..139132 | - | 282 | WP_058145534.1 | type II toxin-antitoxin system toxin ParE | Toxin |
OBG92_RS00650 (OBG92_00127) | 139129..139356 | - | 228 | WP_034081045.1 | CopG family ribbon-helix-helix protein | Antitoxin |
OBG92_RS00655 (OBG92_00128) | 139532..140152 | - | 621 | WP_058145551.1 | hypothetical protein | - |
OBG92_RS00660 (OBG92_00129) | 140253..140753 | + | 501 | WP_034081042.1 | LEA type 2 family protein | - |
OBG92_RS00665 (OBG92_00130) | 140826..141167 | + | 342 | WP_003101229.1 | zinc ribbon domain-containing protein YjdM | - |
OBG92_RS00670 (OBG92_00131) | 141287..142714 | - | 1428 | WP_058135775.1 | GABA permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 10419.13 Da Isoelectric Point: 9.6558
>T261967 WP_058145534.1 NZ_CP109657:c139132-138851 [Pseudomonas aeruginosa]
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDVVEQVKPLQEVANQGAGRPSEVPGVRTLALERWPFSAPFRVKGKE
IQILRIDRVEITP
MSLKWTRKAAADLDAIYDHYVVLIGPEKALKAVQDVVEQVKPLQEVANQGAGRPSEVPGVRTLALERWPFSAPFRVKGKE
IQILRIDRVEITP
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2R3IRV5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4P0TKN5 |