Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | FicTA/Fic(toxin) |
| Location | 11987..12878 | Replicon | plasmid unnamed |
| Accession | NZ_CP109655 | ||
| Organism | Campylobacter coli strain 10-02932 | ||
Toxin (Protein)
| Gene name | Fic | Uniprot ID | - |
| Locus tag | OKF33_RS09055 | Protein ID | WP_057039918.1 |
| Coordinates | 11987..12640 (-) | Length | 218 a.a. |
Antitoxin (Protein)
| Gene name | Fti | Uniprot ID | - |
| Locus tag | OKF33_RS09060 | Protein ID | WP_072225153.1 |
| Coordinates | 12624..12878 (-) | Length | 85 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OKF33_RS09025 | 7292..7675 | + | 384 | WP_002797386.1 | DNA transfer protein | - |
| OKF33_RS09030 | 7638..9794 | + | 2157 | WP_023361569.1 | relaxase/mobilization nuclease domain-containing protein | - |
| OKF33_RS09035 | 10035..10274 | - | 240 | WP_070312165.1 | hypothetical protein | - |
| OKF33_RS09040 | 10277..10963 | - | 687 | WP_002791558.1 | AAA family ATPase | - |
| OKF33_RS09045 | 11055..11450 | - | 396 | WP_264306154.1 | conjugal transfer protein TraM | - |
| OKF33_RS09050 | 11515..11982 | - | 468 | WP_057039919.1 | signal peptidase I | - |
| OKF33_RS09055 | 11987..12640 | - | 654 | WP_057039918.1 | Fic family protein | Toxin |
| OKF33_RS09060 | 12624..12878 | - | 255 | WP_072225153.1 | hypothetical protein | Antitoxin |
| OKF33_RS09065 | 12972..13691 | - | 720 | WP_264306155.1 | conjugal transfer protein TraL | - |
| OKF33_RS09070 | 13702..15525 | - | 1824 | WP_057031751.1 | type IV secretory system conjugative DNA transfer family protein | - |
| OKF33_RS09075 | 15522..17735 | - | 2214 | WP_002790336.1 | zincin-like metallopeptidase domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..26047 | 26047 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 218 a.a. Molecular weight: 25109.68 Da Isoelectric Point: 10.0342
>T261966 WP_057039918.1 NZ_CP109655:c12640-11987 [Campylobacter coli]
MKENNEELFKRLITDNKLGIKDEKLFDKESRFYTGLRERELTLNPIKGNFDYQHLKNIHKHIFQDVFHWAGKDRMEVGLH
GNFGKYAPNGTITNFVPGKDLNATAQQIFTWLKEDNYLKNSKDLNDFAKNLAEFARNLNALHPFREGNGRTQRIFLNELA
KNAGYKLDLNLIPKDKTIMASVEASQLKLGKLEAIIKTNLKSFRQNLDLEQNKGISL
MKENNEELFKRLITDNKLGIKDEKLFDKESRFYTGLRERELTLNPIKGNFDYQHLKNIHKHIFQDVFHWAGKDRMEVGLH
GNFGKYAPNGTITNFVPGKDLNATAQQIFTWLKEDNYLKNSKDLNDFAKNLAEFARNLNALHPFREGNGRTQRIFLNELA
KNAGYKLDLNLIPKDKTIMASVEASQLKLGKLEAIIKTNLKSFRQNLDLEQNKGISL
Download Length: 654 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|