Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazEF/MazF(toxin) |
| Location | 522130..522766 | Replicon | chromosome |
| Accession | NZ_CP109651 | ||
| Organism | Bacillus safensis strain LG01 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | A0A0P7G713 |
| Locus tag | N8A73_RS02520 | Protein ID | WP_024425388.1 |
| Coordinates | 522416..522766 (+) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | mazE | Uniprot ID | W8QJ31 |
| Locus tag | N8A73_RS02515 | Protein ID | WP_003214273.1 |
| Coordinates | 522130..522411 (+) | Length | 94 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N8A73_RS02495 | 518284..518889 | - | 606 | WP_041116754.1 | rhomboid family intramembrane serine protease | - |
| N8A73_RS02500 | 518984..519349 | + | 366 | WP_041116756.1 | holo-ACP synthase | - |
| N8A73_RS02505 | 519510..520526 | + | 1017 | WP_098677666.1 | outer membrane lipoprotein-sorting protein | - |
| N8A73_RS02510 | 520654..521835 | + | 1182 | WP_061110629.1 | alanine racemase | - |
| N8A73_RS02515 | 522130..522411 | + | 282 | WP_003214273.1 | hypothetical protein | Antitoxin |
| N8A73_RS02520 | 522416..522766 | + | 351 | WP_024425388.1 | type II toxin-antitoxin system endoribonuclease NdoA | Toxin |
| N8A73_RS02525 | 522882..523712 | + | 831 | WP_034283948.1 | RsbT co-antagonist protein RsbRA | - |
| N8A73_RS02530 | 523717..524085 | + | 369 | WP_003214235.1 | RsbT antagonist protein RsbS | - |
| N8A73_RS02535 | 524088..524489 | + | 402 | WP_024427376.1 | anti-sigma regulatory factor | - |
| N8A73_RS02540 | 524500..525507 | + | 1008 | WP_024427377.1 | PP2C family protein-serine/threonine phosphatase | - |
| N8A73_RS02545 | 525567..525896 | + | 330 | WP_024425392.1 | anti-sigma factor antagonist | - |
| N8A73_RS02550 | 525893..526381 | + | 489 | WP_034283945.1 | anti-sigma B factor RsbW | - |
| N8A73_RS02555 | 526347..527135 | + | 789 | WP_024427378.1 | RNA polymerase sigma factor SigB | - |
| N8A73_RS02560 | 527135..527734 | + | 600 | WP_176967302.1 | PP2C family serine/threonine-protein phosphatase | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12977.98 Da Isoelectric Point: 4.8891
>T261965 WP_024425388.1 NZ_CP109651:522416-522766 [Bacillus safensis]
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
MIVKRGDVYFADLSPVVGSEQGGVRPVLVIQNDIGNRFSPTAIVAAITAQIQKAKLPTHVEIDAKRYGFERDSVILLEQI
RTIDKQRLTDKITHLDDEMMEKVDEALQVSLALIDF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0P7G713 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A081L854 |