Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | mazF-pemI/MazF(toxin) |
| Location | 3438504..3439137 | Replicon | chromosome |
| Accession | NZ_CP109616 | ||
| Organism | Weizmannia sp. WK01 | ||
Toxin (Protein)
| Gene name | mazF | Uniprot ID | G2TIM0 |
| Locus tag | OF158_RS16375 | Protein ID | WP_013860680.1 |
| Coordinates | 3438504..3438854 (-) | Length | 117 a.a. |
Antitoxin (Protein)
| Gene name | pemI | Uniprot ID | G2TIL9 |
| Locus tag | OF158_RS16380 | Protein ID | WP_014096808.1 |
| Coordinates | 3438859..3439137 (-) | Length | 93 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OF158_RS16340 (OF158_16340) | 3433761..3434540 | - | 780 | WP_014096815.1 | RNA polymerase sigma factor SigB | - |
| OF158_RS16345 (OF158_16345) | 3434518..3434988 | - | 471 | WP_014096814.1 | anti-sigma B factor RsbW | - |
| OF158_RS16350 (OF158_16350) | 3434992..3435327 | - | 336 | WP_026104587.1 | anti-sigma factor antagonist | - |
| OF158_RS16355 (OF158_16355) | 3435397..3436407 | - | 1011 | WP_017551130.1 | PP2C family protein-serine/threonine phosphatase | - |
| OF158_RS16360 (OF158_16360) | 3436421..3436822 | - | 402 | WP_014096811.1 | anti-sigma regulatory factor | - |
| OF158_RS16365 (OF158_16365) | 3436827..3437183 | - | 357 | WP_014096810.1 | STAS domain-containing protein | - |
| OF158_RS16370 (OF158_16370) | 3437187..3438014 | - | 828 | WP_014096809.1 | RsbT co-antagonist protein RsbRA | - |
| OF158_RS16375 (OF158_16375) | 3438504..3438854 | - | 351 | WP_013860680.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
| OF158_RS16380 (OF158_16380) | 3438859..3439137 | - | 279 | WP_014096808.1 | hypothetical protein | Antitoxin |
| OF158_RS16385 (OF158_16385) | 3439290..3440441 | - | 1152 | WP_014096807.1 | alanine racemase | - |
| OF158_RS16390 (OF158_16390) | 3440643..3441659 | - | 1017 | WP_035183268.1 | outer membrane lipoprotein carrier protein LolA | - |
| OF158_RS16395 (OF158_16395) | 3441800..3442150 | - | 351 | WP_014096805.1 | holo-ACP synthase | - |
| OF158_RS16400 (OF158_16400) | 3442431..3443030 | + | 600 | WP_014096804.1 | rhomboid family intramembrane serine protease | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 117 a.a. Molecular weight: 12968.01 Da Isoelectric Point: 4.8998
>T261960 WP_013860680.1 NZ_CP109616:c3438854-3438504 [Weizmannia sp. WK01]
MIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGLERDSVILLEQI
RTIDKQRLTDKITHLDEEVMEKIDDALQISLGLVEF
MIVKRGDVYFADLSPVVGSEQGGVRPVLILQNDIGNRFSPTVIVAAITAQIQKAKLPTHVEIDAKRYGLERDSVILLEQI
RTIDKQRLTDKITHLDEEVMEKIDDALQISLGLVEF
Download Length: 351 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4BYJ0 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A8B4BX66 |