Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 60845..61370 Replicon plasmid pKP20-425-1-1
Accession NZ_CP109615
Organism Klebsiella sp. KP20-425-1

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag OHJ17_RS25835 Protein ID WP_013023785.1
Coordinates 61065..61370 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag OHJ17_RS25830 Protein ID WP_001568025.1
Coordinates 60845..61063 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OHJ17_RS25800 (OHJ17_25220) 56335..57024 + 690 WP_020315560.1 RES family NAD+ phosphorylase -
OHJ17_RS25805 (OHJ17_25225) 57056..57745 - 690 WP_004193995.1 hypothetical protein -
OHJ17_RS25810 (OHJ17_25230) 58012..58893 + 882 WP_223289722.1 hypothetical protein -
OHJ17_RS25815 (OHJ17_25235) 58995..59243 + 249 WP_053389907.1 hypothetical protein -
OHJ17_RS25820 (OHJ17_25240) 59297..60283 - 987 WP_223289723.1 hypothetical protein -
OHJ17_RS25825 (OHJ17_25245) 60421..60675 + 255 Protein_59 hypothetical protein -
OHJ17_RS25830 (OHJ17_25250) 60845..61063 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
OHJ17_RS25835 (OHJ17_25255) 61065..61370 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
OHJ17_RS25840 (OHJ17_25260) 61539..61934 + 396 WP_162269742.1 hypothetical protein -
OHJ17_RS25845 (OHJ17_25265) 61961..62275 + 315 WP_053389906.1 hypothetical protein -
OHJ17_RS25850 (OHJ17_25270) 62286..63302 + 1017 WP_017899884.1 hypothetical protein -
OHJ17_RS25855 (OHJ17_25275) 63500..64294 + 795 WP_053389905.1 site-specific integrase -
OHJ17_RS25860 (OHJ17_25280) 64782..65084 - 303 WP_004197636.1 hypothetical protein -
OHJ17_RS25865 (OHJ17_25285) 65081..65707 - 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaKPC-2 - 1..159149 159149


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T261959 WP_013023785.1 NZ_CP109615:61065-61370 [Klebsiella sp. KP20-425-1]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT261959 WP_001568025.1 NZ_CP109615:60845-61063 [Klebsiella sp. KP20-425-1]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References