Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-RelB |
Location | 4669178..4669694 | Replicon | chromosome |
Accession | NZ_CP109614 | ||
Organism | Klebsiella sp. KP20-425-1 |
Toxin (Protein)
Gene name | relE | Uniprot ID | A0A2A2BGN7 |
Locus tag | OHJ17_RS22780 | Protein ID | WP_009486548.1 |
Coordinates | 4669178..4669462 (-) | Length | 95 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | R4Y888 |
Locus tag | OHJ17_RS22785 | Protein ID | WP_002886901.1 |
Coordinates | 4669452..4669694 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OHJ17_RS22755 (4664595) | 4664595..4664858 | - | 264 | WP_014908078.1 | PTS sugar transporter subunit IIB | - |
OHJ17_RS22760 (4664988) | 4664988..4665161 | + | 174 | WP_032433782.1 | hypothetical protein | - |
OHJ17_RS22765 (4665164) | 4665164..4665907 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
OHJ17_RS22770 (4666264) | 4666264..4668402 | + | 2139 | WP_004186701.1 | anaerobic ribonucleoside-triphosphate reductase | - |
OHJ17_RS22775 (4668710) | 4668710..4669174 | + | 465 | WP_002886903.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
OHJ17_RS22780 (4669178) | 4669178..4669462 | - | 285 | WP_009486548.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OHJ17_RS22785 (4669452) | 4669452..4669694 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
OHJ17_RS22790 (4669772) | 4669772..4671682 | - | 1911 | WP_009486549.1 | PRD domain-containing protein | - |
OHJ17_RS22795 (4671705) | 4671705..4672859 | - | 1155 | WP_002886900.1 | lactonase family protein | - |
OHJ17_RS22800 (4672926) | 4672926..4673666 | - | 741 | WP_009486551.1 | KDGP aldolase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11125.95 Da Isoelectric Point: 10.4951
>T261956 WP_009486548.1 NZ_CP109614:c4669462-4669178 [Klebsiella sp. KP20-425-1]
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRARREWQKPGETVKKQFKNKLQQIVQNPRIESTRLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A2A2BGN7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GLP0 |