Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3931374..3931993 Replicon chromosome
Accession NZ_CP109614
Organism Klebsiella sp. KP20-425-1

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OHJ17_RS19305 Protein ID WP_002892050.1
Coordinates 3931775..3931993 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OHJ17_RS19300 Protein ID WP_002892066.1
Coordinates 3931374..3931748 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OHJ17_RS19290 (3926526) 3926526..3927719 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OHJ17_RS19295 (3927742) 3927742..3930888 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OHJ17_RS19300 (3931374) 3931374..3931748 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OHJ17_RS19305 (3931775) 3931775..3931993 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OHJ17_RS19310 (3932156) 3932156..3932722 + 567 WP_002892030.1 maltose O-acetyltransferase -
OHJ17_RS19315 (3932694) 3932694..3932834 - 141 WP_004147370.1 hypothetical protein -
OHJ17_RS19320 (3932855) 3932855..3933325 + 471 WP_020802585.1 YlaC family protein -
OHJ17_RS19325 (3933300) 3933300..3934751 - 1452 WP_004183206.1 PLP-dependent aminotransferase family protein -
OHJ17_RS19330 (3934852) 3934852..3935550 + 699 WP_023287311.1 GNAT family protein -
OHJ17_RS19335 (3935547) 3935547..3935687 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OHJ17_RS19340 (3935687) 3935687..3935950 - 264 WP_032432663.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T261954 WP_002892050.1 NZ_CP109614:3931775-3931993 [Klebsiella sp. KP20-425-1]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT261954 WP_002892066.1 NZ_CP109614:3931374-3931748 [Klebsiella sp. KP20-425-1]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References