Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1466726..1467462 | Replicon | chromosome |
Accession | NZ_CP109614 | ||
Organism | Klebsiella sp. KP20-425-1 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A4S4Y1H2 |
Locus tag | OHJ17_RS07260 | Protein ID | WP_032433360.1 |
Coordinates | 1466980..1467462 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | L7SZ29 |
Locus tag | OHJ17_RS07255 | Protein ID | WP_003026799.1 |
Coordinates | 1466726..1466992 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OHJ17_RS07230 (1462372) | 1462372..1463511 | + | 1140 | WP_032433368.1 | mannitol dehydrogenase | - |
OHJ17_RS07235 (1463540) | 1463540..1464202 | + | 663 | WP_032433366.1 | dihydroxyacetone kinase subunit DhaL | - |
OHJ17_RS07240 (1464186) | 1464186..1465190 | + | 1005 | WP_032433364.1 | dihydroxyacetone kinase subunit DhaK | - |
OHJ17_RS07245 (1465208) | 1465208..1465840 | + | 633 | WP_032433362.1 | 3-hexulose-6-phosphate synthase | - |
OHJ17_RS07250 (1465850) | 1465850..1466413 | + | 564 | WP_032433361.1 | 6-phospho-3-hexuloisomerase | - |
OHJ17_RS07255 (1466726) | 1466726..1466992 | + | 267 | WP_003026799.1 | DUF1778 domain-containing protein | Antitoxin |
OHJ17_RS07260 (1466980) | 1466980..1467462 | + | 483 | WP_032433360.1 | GNAT family N-acetyltransferase | Toxin |
OHJ17_RS07265 (1467662) | 1467662..1469065 | + | 1404 | WP_267303048.1 | ISNCY-like element ISKpn21 family transposase | - |
OHJ17_RS07270 (1469094) | 1469094..1469325 | - | 232 | Protein_1419 | hypothetical protein | - |
OHJ17_RS07275 (1469588) | 1469588..1470187 | - | 600 | WP_032432064.1 | helix-turn-helix transcriptional regulator | - |
OHJ17_RS07280 (1470400) | 1470400..1471344 | - | 945 | WP_077254249.1 | fimbrial protein | - |
OHJ17_RS07285 (1471356) | 1471356..1471934 | - | 579 | WP_032432061.1 | type 1 fimbrial protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1434671..1480170 | 45499 | |
- | flank | IS/Tn | - | - | 1467662..1469065 | 1403 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17421.02 Da Isoelectric Point: 9.6047
>T261948 WP_032433360.1 NZ_CP109614:1466980-1467462 [Klebsiella sp. KP20-425-1]
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
VGRVTAPEPLSSSHQLAEFVSGETVLDEWLKHRGLKNQALGAARTFVVCKTGTKQVAGFYSLATGSVNHTETTGRLRRNM
PDPIPVIILARLAVDVSLHGKGVGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKGFYTHHGFTASQTHERTLFLKLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S4Y1H2 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A1Q8YL66 |