Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vagCD/VapC-VagC |
Location | 1450035..1450678 | Replicon | chromosome |
Accession | NZ_CP109614 | ||
Organism | Klebsiella sp. KP20-425-1 |
Toxin (Protein)
Gene name | vagD | Uniprot ID | A0A4S8C081 |
Locus tag | OHJ17_RS07165 | Protein ID | WP_032433387.1 |
Coordinates | 1450262..1450678 (+) | Length | 139 a.a. |
Antitoxin (Protein)
Gene name | vagC | Uniprot ID | Q84A07 |
Locus tag | OHJ17_RS07160 | Protein ID | WP_001261276.1 |
Coordinates | 1450035..1450265 (+) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OHJ17_RS07145 (1445057) | 1445057..1446144 | + | 1088 | Protein_1394 | transcriptional regulator | - |
OHJ17_RS07150 (1446147) | 1446147..1448387 | + | 2241 | WP_045326788.1 | P-loop NTPase fold protein | - |
OHJ17_RS07155 (1448915) | 1448915..1449730 | - | 816 | WP_032433388.1 | hypothetical protein | - |
OHJ17_RS07160 (1450035) | 1450035..1450265 | + | 231 | WP_001261276.1 | type II toxin-antitoxin system VapB family antitoxin | Antitoxin |
OHJ17_RS07165 (1450262) | 1450262..1450678 | + | 417 | WP_032433387.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OHJ17_RS07170 (1450834) | 1450834..1451814 | + | 981 | WP_032433385.1 | hypothetical protein | - |
OHJ17_RS07175 (1452009) | 1452009..1453580 | - | 1572 | WP_032433383.1 | AAA family ATPase | - |
OHJ17_RS07180 (1453899) | 1453899..1454147 | + | 249 | WP_032433382.1 | hypothetical protein | - |
OHJ17_RS07185 (1454206) | 1454206..1454724 | + | 519 | WP_045326794.1 | hypothetical protein | - |
OHJ17_RS07190 (1454755) | 1454755..1455246 | + | 492 | WP_032433378.1 | hypothetical protein | - |
OHJ17_RS07195 (1455306) | 1455306..1455509 | + | 204 | WP_032433376.1 | HHA domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1434671..1480170 | 45499 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 139 a.a. Molecular weight: 14974.43 Da Isoelectric Point: 7.8921
>T261947 WP_032433387.1 NZ_CP109614:1450262-1450678 [Klebsiella sp. KP20-425-1]
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
MKKTWMLDTNICSFIMREQPAAVLKRLEQAVLRGDRIVVSAVTYAEMRFGATGPKASPRHIQLVDAFCARLDAILPWDRA
AVDATTDIRVALHLAGTPIGPNDTAIAGHAIAAGAVLVTNNVREFARVPGLTLEDWVI
Download Length: 417 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A4S8C081 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A387K023 |