Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | omega-epsilon-zeta/zeta-epsilon |
Location | 47127..48264 | Replicon | plasmid pAFL-109F |
Accession | NZ_CP109613 | ||
Organism | Enterococcus faecalis strain AFL-109F |
Toxin (Protein)
Gene name | zeta | Uniprot ID | - |
Locus tag | OGM83_RS14105 | Protein ID | WP_283658642.1 |
Coordinates | 47127..47990 (-) | Length | 288 a.a. |
Antitoxin (Protein)
Gene name | epsilon | Uniprot ID | B3CKC7 |
Locus tag | OGM83_RS14110 | Protein ID | WP_002333002.1 |
Coordinates | 47992..48264 (-) | Length | 91 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGM83_RS14080 (42402) | 42402..42926 | + | 525 | WP_010717848.1 | IS30 family transposase | - |
OGM83_RS14085 (42998) | 42998..44611 | - | 1614 | WP_002333004.1 | hypothetical protein | - |
OGM83_RS14090 (44635) | 44635..45516 | - | 882 | WP_002326774.1 | ABC transporter ATP-binding protein | - |
OGM83_RS14095 (45827) | 45827..46423 | + | 597 | WP_002326773.1 | TetR/AcrR family transcriptional regulator | - |
OGM83_RS14100 (46592) | 46592..46996 | - | 405 | Protein_51 | DnaJ domain-containing protein | - |
OGM83_RS14105 (47127) | 47127..47990 | - | 864 | WP_283658642.1 | zeta toxin family protein | Toxin |
OGM83_RS14110 (47992) | 47992..48264 | - | 273 | WP_002333002.1 | antitoxin | Antitoxin |
OGM83_RS14115 (48282) | 48282..48497 | - | 216 | WP_001835296.1 | peptide-binding protein | - |
OGM83_RS14120 (48589) | 48589..49485 | - | 897 | WP_104681373.1 | ParA family protein | - |
OGM83_RS14125 (49588) | 49588..51423 | - | 1836 | WP_232035937.1 | type IA DNA topoisomerase | - |
OGM83_RS14130 (51641) | 51641..51871 | + | 231 | WP_181039775.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | erm(A) / optrA / fexA / dfrG / aph(3')-III / erm(B) | prgB/asc10 | 1..74497 | 74497 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 288 a.a. Molecular weight: 32391.84 Da Isoelectric Point: 6.3643
>T261943 WP_283658642.1 NZ_CP109613:c47990-47127 [Enterococcus faecalis]
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVVVIDNDTFKQQHPNFDELV
KLYEKDVVKHATPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKTYAMAVPKIESYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYLSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
MANIVNFTDKQFENRLNDNLEELVQGKKAVESPTAFLLGGQPGSGKTSLRSAIFEETQGNVVVIDNDTFKQQHPNFDELV
KLYEKDVVKHATPYSNRMTEALISRLSDQGYNLVIEGTGRTTDVPIQTATMLQAKGYETKTYAMAVPKIESYLGTIERYE
TMYADDPMTARATPKQAHDIVVKNLPTNLETLHKTGLFSDIRLYNREGVKLYLSLETPSISPKETLERELNRKVSGKEIQ
PTLERIEQKMVQNQHQETPEFKAIQQKMESLQPPTPPIPKTPKLPGI
Download Length: 864 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|