Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) mazEF/PRK09907(toxin)
Location 54736..55307 Replicon plasmid unnamed
Accession NZ_CP109612
Organism Enterococcus faecalis strain AFL-109F

Toxin (Protein)


Gene name mazF Uniprot ID A0A2P6BPI5
Locus tag OGM83_RS13750 Protein ID WP_002394791.1
Coordinates 54736..55077 (-) Length 114 a.a.

Antitoxin (Protein)


Gene name mazE Uniprot ID R3KHK9
Locus tag OGM83_RS13755 Protein ID WP_002362431.1
Coordinates 55077..55307 (-) Length 77 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OGM83_RS13730 (OGM83_13730) 51180..51662 + 483 WP_010817773.1 PTS glucose transporter subunit IIA -
OGM83_RS13735 (OGM83_13735) 51902..52582 + 681 WP_071621256.1 IS6 family transposase -
OGM83_RS13740 (OGM83_13740) 52816..53418 - 603 WP_002367780.1 Fic family protein -
OGM83_RS13745 (OGM83_13745) 53686..54624 - 939 WP_002394789.1 hypothetical protein -
OGM83_RS13750 (OGM83_13750) 54736..55077 - 342 WP_002394791.1 type II toxin-antitoxin system PemK/MazF family toxin Toxin
OGM83_RS13755 (OGM83_13755) 55077..55307 - 231 WP_002362431.1 hypothetical protein Antitoxin
OGM83_RS13760 (OGM83_13760) 55511..56131 + 621 WP_002367784.1 recombinase family protein -
OGM83_RS13765 (OGM83_13765) 56121..56435 + 315 WP_002367785.1 hypothetical protein -
OGM83_RS13770 (OGM83_13770) 56429..56635 + 207 WP_002367786.1 hypothetical protein -
OGM83_RS13775 (OGM83_13775) 56795..56989 + 195 WP_002367787.1 hypothetical protein -
OGM83_RS13780 (OGM83_13780) 57001..57192 + 192 WP_002367788.1 hypothetical protein -
OGM83_RS13785 (OGM83_13785) 57362..57577 + 216 WP_002367791.1 leucocin A/sakacin P family class II bacteriocin -
OGM83_RS13790 (OGM83_13790) 57578..57919 + 342 WP_002367792.1 bacteriocin immunity protein -
OGM83_RS13795 (OGM83_13795) 58335..58853 + 519 WP_002367793.1 hypothetical protein -
OGM83_RS13800 (OGM83_13800) 58801..59016 + 216 WP_002415356.1 hypothetical protein -
OGM83_RS13805 (OGM83_13805) 59108..59194 + 87 WP_012881081.1 type I toxin-antitoxin system Fst family toxin -
OGM83_RS13810 (OGM83_13810) 59451..59747 + 297 WP_002367795.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid cat / tet(L) / tet(M) / erm(B) bsh 1..64400 64400
- flank IS/Tn - - 52124..52582 458


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

mRNA interferase PemK-like

(10-112)

Antitoxin


No domain identified.



Sequences

Toxin        


Download         Length: 114 a.a.        Molecular weight: 13248.49 Da        Isoelectric Point: 8.8595

>T261942 WP_002394791.1 NZ_CP109612:c55077-54736 [Enterococcus faecalis]
MSDEKKYIPKKGDIVWIDFDPSVGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNMPTRYTLPDEMETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF

Download         Length: 342 bp

Antitoxin


Download         Length: 77 a.a.        Molecular weight: 8510.42 Da        Isoelectric Point: 4.3855

>AT261942 WP_002362431.1 NZ_CP109612:c55307-55077 [Enterococcus faecalis]
MLTTKSRKQGSSVVLTLPSNNGQKPKADQEYIVMYSDDGTITLVPKLQDPFSGGSEGEYYEKDEWHDIEPGGRELF

Download         Length: 231 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P6BPI5

Antitoxin

Source ID Structure
AlphaFold DB R3KHK9

References