Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907(toxin) |
Location | 2673830..2674401 | Replicon | chromosome |
Accession | NZ_CP109611 | ||
Organism | Enterococcus faecalis strain AFL-109F |
Toxin (Protein)
Gene name | mazF | Uniprot ID | R3GRA7 |
Locus tag | OGM83_RS12990 | Protein ID | WP_002360937.1 |
Coordinates | 2673830..2674171 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | S4CGQ1 |
Locus tag | OGM83_RS12995 | Protein ID | WP_002367500.1 |
Coordinates | 2674171..2674401 (-) | Length | 77 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGM83_RS12985 (2669694) | 2669694..2673308 | - | 3615 | WP_002389470.1 | DNA-directed RNA polymerase subunit beta | - |
OGM83_RS12990 (2673830) | 2673830..2674171 | - | 342 | WP_002360937.1 | type II toxin-antitoxin system PemK/MazF family toxin | Toxin |
OGM83_RS12995 (2674171) | 2674171..2674401 | - | 231 | WP_002367500.1 | hypothetical protein | Antitoxin |
OGM83_RS13000 (2674724) | 2674724..2674939 | - | 216 | WP_002354768.1 | zinc ribbon domain-containing protein | - |
OGM83_RS13005 (2675078) | 2675078..2676070 | + | 993 | WP_192177101.1 | biotin--[acetyl-CoA-carboxylase] ligase | - |
OGM83_RS13010 (2676160) | 2676160..2676759 | - | 600 | WP_225560887.1 | RloB family protein | - |
OGM83_RS13015 (2676768) | 2676768..2678063 | - | 1296 | WP_192177102.1 | ATP-binding protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 13165.41 Da Isoelectric Point: 9.3988
>T261935 WP_002360937.1 NZ_CP109611:c2674171-2673830 [Enterococcus faecalis]
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
MNVEKKYIPKKGDIVWIDFDPAAGKEIQKRRPGLVVSRYEFNRKTMFAVICPITSTIKNIPTRYTLPDDIETHGQVVISQ
LKSLDFTERKLSQIEHLPLKDMAKIDQIIEYIF
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0M2A7G9 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | S4CGQ1 |