Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | ImmA-IrrE/HTH_26(antitoxin) |
Location | 2325215..2325913 | Replicon | chromosome |
Accession | NZ_CP109611 | ||
Organism | Enterococcus faecalis strain AFL-109F |
Toxin (Protein)
Gene name | IrrE | Uniprot ID | - |
Locus tag | OGM83_RS11350 | Protein ID | WP_010827745.1 |
Coordinates | 2325569..2325913 (+) | Length | 115 a.a. |
Antitoxin (Protein)
Gene name | ImmA | Uniprot ID | - |
Locus tag | OGM83_RS11345 | Protein ID | WP_023895324.1 |
Coordinates | 2325215..2325550 (+) | Length | 112 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGM83_RS11295 (2320341) | 2320341..2321096 | - | 756 | WP_142431263.1 | DnaD domain protein | - |
OGM83_RS11300 (2321111) | 2321111..2321926 | - | 816 | WP_161972134.1 | PD-(D/E)XK nuclease-like domain-containing protein | - |
OGM83_RS11305 (2321889) | 2321889..2322860 | - | 972 | WP_104878921.1 | RecT family recombinase | - |
OGM83_RS11310 (2322910) | 2322910..2323230 | + | 321 | WP_010707143.1 | hypothetical protein | - |
OGM83_RS11315 (2323249) | 2323249..2323554 | - | 306 | WP_002395805.1 | hypothetical protein | - |
OGM83_RS11320 (2323657) | 2323657..2323881 | - | 225 | WP_002367281.1 | hypothetical protein | - |
OGM83_RS11325 (2323878) | 2323878..2324177 | - | 300 | WP_010706856.1 | hypothetical protein | - |
OGM83_RS11330 (2324244) | 2324244..2324423 | - | 180 | WP_010829956.1 | hypothetical protein | - |
OGM83_RS11335 (2324458) | 2324458..2324727 | - | 270 | WP_002365131.1 | hypothetical protein | - |
OGM83_RS11340 (2324740) | 2324740..2324922 | - | 183 | WP_002358110.1 | hypothetical protein | - |
OGM83_RS11345 (2325215) | 2325215..2325550 | + | 336 | WP_023895324.1 | helix-turn-helix transcriptional regulator | Antitoxin |
OGM83_RS11350 (2325569) | 2325569..2325913 | + | 345 | WP_010827745.1 | ImmA/IrrE family metallo-endopeptidase | Toxin |
OGM83_RS11355 (2325971) | 2325971..2326699 | + | 729 | WP_002385631.1 | potassium channel family protein | - |
OGM83_RS11360 (2326854) | 2326854..2328035 | + | 1182 | WP_271232261.1 | site-specific integrase | - |
OGM83_RS11365 (2328138) | 2328138..2328287 | - | 150 | WP_002356321.1 | 50S ribosomal protein L33 | - |
OGM83_RS11370 (2328413) | 2328413..2330548 | - | 2136 | WP_002359399.1 | penicillin-binding protein 2 | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 2286077..2328035 | 41958 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 115 a.a. Molecular weight: 13580.58 Da Isoelectric Point: 5.6177
>T261925 WP_010827745.1 NZ_CP109611:2325569-2325913 [Enterococcus faecalis]
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMALYKIPVFRSKMEAEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEVYLK
MKSIKELVEEYNVELVFTTLNKRACFDPTYGIIFVNQNLTPSEQEEAIYHELKHVKDHVDIMALYKIPVFRSKMEAEAEQ
YMFRSLIEKYEGQYNYSNVIAHYNLKMGQEVYLK
Download Length: 345 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|