Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 74403..75056 Replicon chromosome
Accession NZ_CP109611
Organism Enterococcus faecalis strain AFL-109F

Toxin (Protein)


Gene name hicA Uniprot ID R3IHS7
Locus tag OGM83_RS00320 Protein ID WP_002367585.1
Coordinates 74874..75056 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID R3IHD2
Locus tag OGM83_RS00315 Protein ID WP_010707936.1
Coordinates 74403..74840 (-) Length 146 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OGM83_RS00300 (69679) 69679..70377 + 699 WP_010707934.1 N-acetylmannosamine-6-phosphate 2-epimerase -
OGM83_RS00305 (70555) 70555..72894 + 2340 WP_071646506.1 alpha-glucosidase -
OGM83_RS00310 (73441) 73441..74358 + 918 WP_010713649.1 helix-turn-helix transcriptional regulator -
OGM83_RS00315 (74403) 74403..74840 - 438 WP_010707936.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OGM83_RS00320 (74874) 74874..75056 - 183 WP_002367585.1 type II toxin-antitoxin system HicA family toxin Toxin
OGM83_RS00325 (75161) 75161..75814 - 654 WP_002356081.1 Crp/Fnr family transcriptional regulator -
OGM83_RS00330 (76088) 76088..76981 + 894 WP_010775474.1 SDR family oxidoreductase -
OGM83_RS00335 (76994) 76994..77566 + 573 WP_071646507.1 alkaline shock response membrane anchor protein AmaP -
OGM83_RS00340 (77579) 77579..77770 + 192 WP_002356087.1 DUF2273 domain-containing protein -
OGM83_RS00345 (77783) 77783..78295 + 513 WP_002383483.1 Asp23/Gls24 family envelope stress response protein -
OGM83_RS00350 (78354) 78354..78914 + 561 WP_002356090.1 Asp23/Gls24 family envelope stress response protein -
OGM83_RS00355 (78938) 78938..79180 + 243 WP_002356092.1 GlsB/YeaQ/YmgE family stress response membrane protein -
OGM83_RS00360 (79346) 79346..79861 + 516 WP_071646508.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(6-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(11-71)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6633.06 Da        Isoelectric Point: 10.8756

>T261921 WP_002367585.1 NZ_CP109611:c75056-74874 [Enterococcus faecalis]
MPMTQKQMVKLLKKHGWLPTDGGKGSHIKMEMSGKRPIIIPHGELKKGTEIGILKEAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 146 a.a.        Molecular weight: 16267.27 Da        Isoelectric Point: 4.2758

>AT261921 WP_010707936.1 NZ_CP109611:c74840-74403 [Enterococcus faecalis]
MLISYPACFYSVENGYYVYFPDIGGSGTQGDTIPDAIAMASDYLGMMLSDDIEHQRTIHQPSPINTLSLEDNNPFRDDDD
FNFNLADSFVSMVNVELNDYLGTNTLVKKTVTIPKWSDELGKKNKLNFSKTLTDAIVEKSLHVLK

Download         Length: 438 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB R3IHS7

Antitoxin

Source ID Structure
AlphaFold DB R3IHD2

References