Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) ccdAB/CcdA(antitoxin)
Location 60845..61370 Replicon plasmid pKP18-231-2
Accession NZ_CP109609
Organism Klebsiella pneumoniae strain KP18-231

Toxin (Protein)


Gene name ccdB Uniprot ID D4HQE7
Locus tag OGW23_RS28345 Protein ID WP_013023785.1
Coordinates 61065..61370 (+) Length 102 a.a.

Antitoxin (Protein)


Gene name ccdA Uniprot ID W8V2V6
Locus tag OGW23_RS28340 Protein ID WP_001568025.1
Coordinates 60845..61063 (+) Length 73 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OGW23_RS28310 (OGW23_28315) 56335..57024 + 690 WP_020315560.1 RES family NAD+ phosphorylase -
OGW23_RS28315 (OGW23_28320) 57056..57745 - 690 WP_004193995.1 hypothetical protein -
OGW23_RS28320 (OGW23_28325) 58012..58893 + 882 WP_223289722.1 hypothetical protein -
OGW23_RS28325 (OGW23_28330) 58995..59243 + 249 WP_053389907.1 hypothetical protein -
OGW23_RS28330 (OGW23_28335) 59297..60283 - 987 WP_223289723.1 hypothetical protein -
OGW23_RS28335 (OGW23_28340) 60421..60675 + 255 Protein_59 hypothetical protein -
OGW23_RS28340 (OGW23_28345) 60845..61063 + 219 WP_001568025.1 type II toxin-antitoxin system antitoxin CcdA Antitoxin
OGW23_RS28345 (OGW23_28350) 61065..61370 + 306 WP_013023785.1 type II toxin-antitoxin system toxin CcdB Toxin
OGW23_RS28350 (OGW23_28355) 61539..61934 + 396 WP_162269742.1 hypothetical protein -
OGW23_RS28355 (OGW23_28360) 61961..62275 + 315 WP_053389906.1 hypothetical protein -
OGW23_RS28360 (OGW23_28365) 62286..63302 + 1017 WP_017899884.1 hypothetical protein -
OGW23_RS28365 (OGW23_28370) 63500..64294 + 795 WP_053389905.1 site-specific integrase -
OGW23_RS28370 (OGW23_28375) 64726..65028 - 303 WP_004197636.1 hypothetical protein -
OGW23_RS28375 (OGW23_28380) 65025..65651 - 627 WP_004197649.1 ParA family plasmid-partitioning AAA ATPase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Conjugative plasmid blaKPC-2 - 1..142244 142244


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Toxin CcdB

(2-100)

Antitoxin

Post-segregation antitoxin CcdA

(2-72)


Sequences

Toxin        


Download         Length: 102 a.a.        Molecular weight: 11615.30 Da        Isoelectric Point: 6.4672

>T261920 WP_013023785.1 NZ_CP109609:61065-61370 [Klebsiella pneumoniae]
MQFKVYAYKRESRYRLFVDVQSDIIDTPGRRMVIPLASARLLSDKVSRELYPVVHIGDESYRLMTTDMASVTSSVTGEEV
ADLSHRENDIKNAINLMFWGI

Download         Length: 306 bp

Antitoxin


Download         Length: 73 a.a.        Molecular weight: 8392.34 Da        Isoelectric Point: 4.7405

>AT261920 WP_001568025.1 NZ_CP109609:60845-61063 [Klebsiella pneumoniae]
MKQRITVTIDSDSYQLLKSADVNISALVNRAMQNEARRLRSERWQAENQEGMAEVARFIEMNGSFADENRDW

Download         Length: 219 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2J4ZZW6

Antitoxin

Source ID Structure
AlphaFold DB A0A2J4ZZP8

References