Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | stbDE/ParE-YafN |
| Location | 300190..300712 | Replicon | plasmid pKP18-231-1 |
| Accession | NZ_CP109608 | ||
| Organism | Klebsiella pneumoniae strain KP18-231 | ||
Toxin (Protein)
| Gene name | stbE | Uniprot ID | A0A2J4R0S6 |
| Locus tag | OGW23_RS27710 | Protein ID | WP_004181778.1 |
| Coordinates | 300428..300712 (+) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | stbD | Uniprot ID | A0A2J4R0U8 |
| Locus tag | OGW23_RS27705 | Protein ID | WP_004181777.1 |
| Coordinates | 300190..300438 (+) | Length | 83 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OGW23_RS27685 (OGW23_27690) | 295360..296217 | - | 858 | WP_064371183.1 | hypothetical protein | - |
| OGW23_RS27690 (OGW23_27695) | 296277..296630 | - | 354 | WP_042927270.1 | hypothetical protein | - |
| OGW23_RS27695 (OGW23_27700) | 296766..297770 | - | 1005 | WP_064371184.1 | hypothetical protein | - |
| OGW23_RS27700 (OGW23_27705) | 298099..299898 | - | 1800 | WP_064371185.1 | ATP-dependent helicase | - |
| OGW23_RS27705 (OGW23_27710) | 300190..300438 | + | 249 | WP_004181777.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
| OGW23_RS27710 (OGW23_27715) | 300428..300712 | + | 285 | WP_004181778.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| OGW23_RS27715 (OGW23_27720) | 300733..301104 | - | 372 | WP_223884736.1 | type II toxin-antitoxin system PrlF family antitoxin | - |
| OGW23_RS27720 (OGW23_27725) | 301219..301401 | + | 183 | WP_044349315.1 | type II toxin-antitoxin system HicA family toxin | - |
| OGW23_RS27725 (OGW23_27730) | 301445..301876 | + | 432 | WP_044349313.1 | hypothetical protein | - |
| OGW23_RS27730 (OGW23_27735) | 301881..302168 | + | 288 | WP_044349311.1 | helix-turn-helix transcriptional regulator | - |
| OGW23_RS27735 (OGW23_27740) | 302967..303245 | + | 279 | WP_044349308.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / aac(3)-IId / mph(A) / sul1 / qacE / qnrB6 / aadA16 / dfrA27 / ARR-3 | katA | 1..368951 | 368951 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 10970.69 Da Isoelectric Point: 10.6516
>T261919 WP_004181778.1 NZ_CP109608:300428-300712 [Klebsiella pneumoniae]
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
MTYKLAFNESALKEWKKLGHTIREQFKKKLAERLLNPRVPASQLHGRKDQYKIKLRGAGYRLVYSVNDDVVTVTVIGVGK
RENDDIYNLTKHRN
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4R0S6 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A2J4R0U8 |