Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 87506..88263 | Replicon | plasmid pKP18-231-1 |
Accession | NZ_CP109608 | ||
Organism | Klebsiella pneumoniae strain KP18-231 |
Toxin (Protein)
Gene name | tacT | Uniprot ID | A0A2J4ZXV7 |
Locus tag | OGW23_RS26625 | Protein ID | WP_029497408.1 |
Coordinates | 87781..88263 (+) | Length | 161 a.a. |
Antitoxin (Protein)
Gene name | tacA | Uniprot ID | - |
Locus tag | OGW23_RS26620 | Protein ID | WP_094645258.1 |
Coordinates | 87506..87793 (+) | Length | 96 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGW23_RS26605 (OGW23_26610) | 83679..85048 | + | 1370 | WP_094645257.1 | IS3 family transposase | - |
OGW23_RS26610 (OGW23_26615) | 85574..86146 | + | 573 | WP_094645259.1 | cytochrome b/b6 domain-containing protein | - |
OGW23_RS26615 (OGW23_26620) | 86346..87269 | + | 924 | WP_000167917.1 | cation diffusion facilitator family transporter | - |
OGW23_RS26620 (OGW23_26625) | 87506..87793 | + | 288 | WP_094645258.1 | DUF1778 domain-containing protein | Antitoxin |
OGW23_RS26625 (OGW23_26630) | 87781..88263 | + | 483 | WP_029497408.1 | GNAT family N-acetyltransferase | Toxin |
OGW23_RS26630 (OGW23_26635) | 88544..88696 | + | 153 | Protein_98 | DUF5431 family protein | - |
OGW23_RS26635 (OGW23_26640) | 88644..88763 | + | 120 | WP_223884740.1 | Hok/Gef family protein | - |
OGW23_RS26640 (OGW23_26645) | 88971..89231 | - | 261 | WP_009653224.1 | hypothetical protein | - |
OGW23_RS26645 (OGW23_26650) | 89771..90742 | + | 972 | WP_009653249.1 | hypothetical protein | - |
OGW23_RS26650 (OGW23_26655) | 91105..91482 | - | 378 | WP_042927811.1 | hypothetical protein | - |
OGW23_RS26655 (OGW23_26660) | 93017..93232 | + | 216 | WP_009653220.1 | hypothetical protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | sul2 / aph(3'')-Ib / aph(6)-Id / blaTEM-1B / aac(3)-IId / mph(A) / sul1 / qacE / qnrB6 / aadA16 / dfrA27 / ARR-3 | katA | 1..368951 | 368951 | |
- | flank | IS/Tn | - | - | 84245..85048 | 803 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 161 a.a. Molecular weight: 17599.34 Da Isoelectric Point: 9.8719
>T261918 WP_029497408.1 NZ_CP109608:87781-88263 [Klebsiella pneumoniae]
VGRLTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLRLP
VGRLTAPEPLSAFHQVAEFVSGEAVLDDWLKQKGLKNQALGAARTFVVCKKDTKQVAGFYSLATGSVNHTEATGNLRRNM
PDPIPVIILARLAVDLSFHGKGLGADLLHDAVLRCYRVAENIGVRAIMVHALTEEAKNFYIHHGFKPSQTQQRTLFLRLP
Download Length: 483 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|