Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/LOTUS_5_Limkain_b1(toxin) |
Location | 5249609..5250234 | Replicon | chromosome |
Accession | NZ_CP109607 | ||
Organism | Klebsiella pneumoniae strain KP18-231 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | R4Y4A3 |
Locus tag | OGW23_RS25775 | Protein ID | WP_002882817.1 |
Coordinates | 5249609..5249992 (-) | Length | 128 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | J2DFR0 |
Locus tag | OGW23_RS25780 | Protein ID | WP_004150355.1 |
Coordinates | 5249992..5250234 (-) | Length | 81 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGW23_RS25760 (OGW23_25765) | 5246975..5247877 | + | 903 | WP_002882822.1 | formate dehydrogenase subunit beta | - |
OGW23_RS25765 (OGW23_25770) | 5247874..5248509 | + | 636 | WP_002882818.1 | formate dehydrogenase cytochrome b556 subunit | - |
OGW23_RS25770 (OGW23_25775) | 5248506..5249435 | + | 930 | WP_193525095.1 | formate dehydrogenase accessory protein FdhE | - |
OGW23_RS25775 (OGW23_25780) | 5249609..5249992 | - | 384 | WP_002882817.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OGW23_RS25780 (OGW23_25785) | 5249992..5250234 | - | 243 | WP_004150355.1 | CopG family transcriptional regulator | Antitoxin |
OGW23_RS25785 (OGW23_25790) | 5250439..5251356 | + | 918 | WP_002882812.1 | alpha/beta hydrolase | - |
OGW23_RS25790 (OGW23_25795) | 5251370..5252311 | - | 942 | WP_004178031.1 | fatty acid biosynthesis protein FabY | - |
OGW23_RS25795 (OGW23_25800) | 5252356..5252793 | - | 438 | WP_002882809.1 | D-aminoacyl-tRNA deacylase | - |
OGW23_RS25800 (OGW23_25805) | 5252790..5253650 | - | 861 | WP_002882807.1 | virulence factor BrkB family protein | - |
OGW23_RS25805 (OGW23_25810) | 5253644..5254243 | - | 600 | WP_004151865.1 | glucose-1-phosphatase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 128 a.a. Molecular weight: 14377.62 Da Isoelectric Point: 7.3178
>T261917 WP_002882817.1 NZ_CP109607:c5249992-5249609 [Klebsiella pneumoniae]
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
MTSGSALFDTNILIDLFSGRREAKQALEAWPPQNAISLITWMEVMVGAKKYHQEQRTRMALSTFNIINISQDIAERSVAL
RQEYKLKLPDAIILATAQLHRLELITRNTKDFAGIPGVVTPYEIHPE
Download Length: 384 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GPK8 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GGU9 |