Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 4054593..4055212 Replicon chromosome
Accession NZ_CP109607
Organism Klebsiella pneumoniae strain KP18-231

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag OGW23_RS20035 Protein ID WP_002892050.1
Coordinates 4054994..4055212 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag OGW23_RS20030 Protein ID WP_002892066.1
Coordinates 4054593..4054967 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OGW23_RS20020 (OGW23_20030) 4049745..4050938 + 1194 WP_002892072.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
OGW23_RS20025 (OGW23_20035) 4050961..4054107 + 3147 WP_002892069.1 multidrug efflux RND transporter permease subunit AcrB -
OGW23_RS20030 (OGW23_20040) 4054593..4054967 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
OGW23_RS20035 (OGW23_20045) 4054994..4055212 + 219 WP_002892050.1 HHA domain-containing protein Toxin
OGW23_RS20040 (OGW23_20050) 4055371..4055937 + 567 WP_002892030.1 maltose O-acetyltransferase -
OGW23_RS20045 (OGW23_20055) 4055909..4056049 - 141 WP_004147370.1 hypothetical protein -
OGW23_RS20050 (OGW23_20060) 4056070..4056540 + 471 WP_002892026.1 YlaC family protein -
OGW23_RS20055 (OGW23_20065) 4056515..4057966 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
OGW23_RS20060 (OGW23_20070) 4058067..4058765 + 699 WP_002892021.1 GNAT family protein -
OGW23_RS20065 (OGW23_20075) 4058762..4058902 - 141 WP_002892018.1 type B 50S ribosomal protein L36 -
OGW23_RS20070 (OGW23_20080) 4058902..4059165 - 264 WP_002892011.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T261913 WP_002892050.1 NZ_CP109607:4054994-4055212 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT261913 WP_002892066.1 NZ_CP109607:4054593-4054967 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References