Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | cptAB/Cpta(toxin) |
Location | 870794..871451 | Replicon | chromosome |
Accession | NZ_CP109607 | ||
Organism | Klebsiella pneumoniae strain KP18-231 |
Toxin (Protein)
Gene name | cptA | Uniprot ID | W8UCT0 |
Locus tag | OGW23_RS04395 | Protein ID | WP_002916310.1 |
Coordinates | 871041..871451 (+) | Length | 137 a.a. |
Antitoxin (Protein)
Gene name | cptB | Uniprot ID | W8UQ37 |
Locus tag | OGW23_RS04390 | Protein ID | WP_002916312.1 |
Coordinates | 870794..871060 (+) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGW23_RS04365 (OGW23_04365) | 865950..867383 | - | 1434 | WP_002916322.1 | 6-phospho-beta-glucosidase BglA | - |
OGW23_RS04370 (OGW23_04370) | 867502..868230 | - | 729 | WP_002916321.1 | MurR/RpiR family transcriptional regulator | - |
OGW23_RS04375 (OGW23_04375) | 868280..868591 | + | 312 | WP_002916319.1 | N(4)-acetylcytidine aminohydrolase | - |
OGW23_RS04380 (OGW23_04380) | 868755..869414 | + | 660 | WP_002916317.1 | hemolysin III family protein | - |
OGW23_RS04385 (OGW23_04385) | 869565..870548 | - | 984 | WP_002916313.1 | tRNA-modifying protein YgfZ | - |
OGW23_RS04390 (OGW23_04390) | 870794..871060 | + | 267 | WP_002916312.1 | FAD assembly factor SdhE | Antitoxin |
OGW23_RS04395 (OGW23_04395) | 871041..871451 | + | 411 | WP_002916310.1 | protein YgfX | Toxin |
OGW23_RS04400 (OGW23_04400) | 871458..871979 | - | 522 | WP_002916308.1 | flavodoxin FldB | - |
OGW23_RS04405 (OGW23_04405) | 872080..872976 | + | 897 | WP_004144729.1 | site-specific tyrosine recombinase XerD | - |
OGW23_RS04410 (OGW23_04410) | 872999..873712 | + | 714 | WP_002916301.1 | bifunctional protein-disulfide isomerase/oxidoreductase DsbC | - |
OGW23_RS04415 (OGW23_04415) | 873718..875451 | + | 1734 | WP_004151783.1 | single-stranded-DNA-specific exonuclease RecJ | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 137 a.a. Molecular weight: 16049.85 Da Isoelectric Point: 11.4778
>T261907 WP_002916310.1 NZ_CP109607:871041-871451 [Klebsiella pneumoniae]
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
VVLWQSDLRISWRAQWFSLLLHGVVAALVLLVPWPLSYTPIWLLLLSLVVFDCVRSQRRIHARRGEIKLLTDSRLRWQNA
EWEILGTPWVINSGMLLRLRHVDTRRGQHLWLAADSMDAGEWRDLRRLVLQKPAQE
Download Length: 411 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GSW7 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0H3GY41 |