Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/COG3657-dnstrm_HI1420 |
Location | 4579028..4579616 | Replicon | chromosome |
Accession | NZ_CP109606 | ||
Organism | Pseudomonas putida strain QH1 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | OGV21_RS20750 | Protein ID | WP_264316450.1 |
Coordinates | 4579028..4579330 (+) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | B0KS04 |
Locus tag | OGV21_RS20755 | Protein ID | WP_012273611.1 |
Coordinates | 4579323..4579616 (+) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGV21_RS20725 | 4575042..4575170 | - | 129 | WP_009683677.1 | PA1414 family protein | - |
OGV21_RS20730 | 4575295..4576188 | - | 894 | WP_012273606.1 | LysR family transcriptional regulator | - |
OGV21_RS20735 | 4576295..4577455 | + | 1161 | WP_060515451.1 | MFS transporter | - |
OGV21_RS20740 | 4577424..4578350 | - | 927 | WP_012273608.1 | DMT family transporter | - |
OGV21_RS20745 | 4578456..4578851 | - | 396 | WP_012273609.1 | hypothetical protein | - |
OGV21_RS20750 | 4579028..4579330 | + | 303 | WP_264316450.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OGV21_RS20755 | 4579323..4579616 | + | 294 | WP_012273611.1 | putative addiction module antidote protein | Antitoxin |
OGV21_RS20760 | 4579706..4579978 | + | 273 | WP_012273612.1 | hypothetical protein | - |
OGV21_RS20765 | 4580101..4581462 | - | 1362 | WP_069943273.1 | DEAD/DEAH box helicase | - |
OGV21_RS20770 | 4581566..4582867 | + | 1302 | WP_012273614.1 | mechanosensitive ion channel family protein | - |
OGV21_RS20775 | 4582884..4583297 | - | 414 | WP_264316451.1 | alternative ribosome rescue aminoacyl-tRNA hydrolase ArfB | - |
OGV21_RS20780 | 4583363..4584298 | - | 936 | WP_264316452.1 | AEC family transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4571231..4590628 | 19397 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11410.01 Da Isoelectric Point: 10.8773
>T261903 WP_264316450.1 NZ_CP109606:4579028-4579330 [Pseudomonas putida]
MKKIESSSFRHWVTGLRDSSARARIISRINRLMEGLPGDVSPVGHGVSELRIHYGPGYRVYFHQTGNTFVILLCSGDKSS
QQRDIKAAHQILRSWRMQND
MKKIESSSFRHWVTGLRDSSARARIISRINRLMEGLPGDVSPVGHGVSELRIHYGPGYRVYFHQTGNTFVILLCSGDKSS
QQRDIKAAHQILRSWRMQND
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|