Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PP_4151-4152/excise(antitoxin) |
Location | 4092477..4093519 | Replicon | chromosome |
Accession | NZ_CP109606 | ||
Organism | Pseudomonas putida strain QH1 |
Toxin (Protein)
Gene name | PP_4152 | Uniprot ID | - |
Locus tag | OGV21_RS18510 | Protein ID | WP_003153636.1 |
Coordinates | 4092477..4093052 (-) | Length | 192 a.a. |
Antitoxin (Protein)
Gene name | PP_4151 | Uniprot ID | I3TV68 |
Locus tag | OGV21_RS18515 | Protein ID | WP_003050245.1 |
Coordinates | 4093049..4093519 (-) | Length | 157 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGV21_RS18485 | 4088915..4089640 | - | 726 | WP_003050273.1 | CBASS effector endonuclease NucC | - |
OGV21_RS18490 | 4089679..4090581 | - | 903 | WP_003153640.1 | CBASS oligonucleotide cyclase | - |
OGV21_RS18495 | 4090581..4091081 | - | 501 | WP_003090159.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap7 | - |
OGV21_RS18500 | 4091078..4091548 | - | 471 | WP_003153638.1 | type III CBASS phage resistance system CD-NTase-associated protein Cap8 | - |
OGV21_RS18505 | 4091545..4092459 | - | 915 | WP_003050256.1 | AAA family ATPase | - |
OGV21_RS18510 | 4092477..4093052 | - | 576 | WP_003153636.1 | PIN domain-containing protein | Toxin |
OGV21_RS18515 | 4093049..4093519 | - | 471 | WP_003050245.1 | helix-turn-helix domain-containing protein | Antitoxin |
OGV21_RS18520 | 4093723..4094106 | + | 384 | WP_003090167.1 | RAQPRD family integrative conjugative element protein | - |
OGV21_RS18525 | 4094103..4094336 | + | 234 | WP_003050225.1 | TIGR03758 family integrating conjugative element protein | - |
OGV21_RS18530 | 4094353..4094712 | + | 360 | WP_003153634.1 | TIGR03745 family integrating conjugative element membrane protein | - |
OGV21_RS18535 | 4094725..4095135 | + | 411 | WP_003821108.1 | TIGR03750 family conjugal transfer protein | - |
OGV21_RS18540 | 4095132..4095824 | + | 693 | WP_012614071.1 | TIGR03746 family integrating conjugative element protein | - |
OGV21_RS18545 | 4095821..4096732 | + | 912 | WP_004350604.1 | TIGR03749 family integrating conjugative element protein | - |
OGV21_RS18550 | 4096722..4098140 | + | 1419 | WP_004350605.1 | TIGR03752 family integrating conjugative element protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 192 a.a. Molecular weight: 21629.78 Da Isoelectric Point: 5.9995
>T261900 WP_003153636.1 NZ_CP109606:c4093052-4092477 [Pseudomonas putida]
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
MRHSPFTAVYDACVLYPAPLRDFLMWLGLSGRFRARWSQAIHEEWKRNLLINRPDLTRVQVDRTSDLMDRAIPDGLVEGY
EALVAGLTLPDPNDRHVLAAAIRCGASVIVTFNERDFPNDLLAPYGIESQHPDEFVDNLLDLDAAAVVSAAQRQRAQLKH
PPIDVDRYLEILLRQGLVQTTKVLATYRTIL
Download Length: 576 bp
Antitoxin
Download Length: 157 a.a. Molecular weight: 17245.62 Da Isoelectric Point: 6.3803
>AT261900 WP_003050245.1 NZ_CP109606:c4093519-4093049 [Pseudomonas putida]
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
MTTATAQSKMTLPAAGEVKAAVQGQRALAAYLATQFETQHIQIFDDHKQAHQVELPTSALRLLVDILAELADGNAVKVVP
VHAELTTQEAADLLNVSRPHFVKLLEDGVLAFHRTGKHRRVRFADLMQYKEARERASEQAMAELAQQSQELGMGYE
Download Length: 471 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|