Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 313110..313712 | Replicon | chromosome |
Accession | NZ_CP109606 | ||
Organism | Pseudomonas putida strain QH1 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | OGV21_RS01380 | Protein ID | WP_179027120.1 |
Coordinates | 313110..313400 (+) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OGV21_RS01385 | Protein ID | WP_060493523.1 |
Coordinates | 313410..313712 (+) | Length | 101 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGV21_RS01360 | 308599..309372 | - | 774 | WP_003257472.1 | ABC transporter ATP-binding protein | - |
OGV21_RS01365 | 310014..311399 | + | 1386 | WP_012270085.1 | GABA permease | - |
OGV21_RS01370 | 311476..311919 | - | 444 | WP_264316738.1 | hypothetical protein | - |
OGV21_RS01375 | 311980..312960 | - | 981 | WP_264316739.1 | polyphosphate kinase 2 | - |
OGV21_RS01380 | 313110..313400 | + | 291 | WP_179027120.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OGV21_RS01385 | 313410..313712 | + | 303 | WP_060493523.1 | putative addiction module antidote protein | Antitoxin |
OGV21_RS01395 | 314015..314287 | - | 273 | WP_003255742.1 | oxidative damage protection protein | - |
OGV21_RS01400 | 314284..315351 | - | 1068 | WP_060493522.1 | A/G-specific adenine glycosylase | - |
OGV21_RS01405 | 315348..317594 | - | 2247 | WP_264316740.1 | AsmA family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10851.65 Da Isoelectric Point: 10.7046
>T261898 WP_179027120.1 NZ_CP109606:313110-313400 [Pseudomonas putida]
MHTLIQTDTYRTWFAALRDPRAKARITVRLRRVGLGVMGDCRPVAEGVSELRIDYGPGYRVYFVRRGYEVIILLAGGDKA
SQARDIKSALKLARDL
MHTLIQTDTYRTWFAALRDPRAKARITVRLRRVGLGVMGDCRPVAEGVSELRIDYGPGYRVYFVRRGYEVIILLAGGDKA
SQARDIKSALKLARDL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|