Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | relBE/ParE-RelB |
| Location | 4655238..4655754 | Replicon | chromosome |
| Accession | NZ_CP109604 | ||
| Organism | Klebsiella pneumoniae strain KP2022 | ||
Toxin (Protein)
| Gene name | relE | Uniprot ID | A0A085DK79 |
| Locus tag | KP2022_RS22665 | Protein ID | WP_009309309.1 |
| Coordinates | 4655238..4655522 (-) | Length | 95 a.a. |
Antitoxin (Protein)
| Gene name | relB | Uniprot ID | R4Y888 |
| Locus tag | KP2022_RS22670 | Protein ID | WP_002886901.1 |
| Coordinates | 4655512..4655754 (-) | Length | 81 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KP2022_RS22640 (4650722) | 4650722..4650985 | - | 264 | WP_004152271.1 | PTS sugar transporter subunit IIB | - |
| KP2022_RS22645 (4651115) | 4651115..4651288 | + | 174 | WP_002886906.1 | hypothetical protein | - |
| KP2022_RS22650 (4651291) | 4651291..4652034 | + | 744 | WP_002886905.1 | MurR/RpiR family transcriptional regulator | - |
| KP2022_RS22655 (4652391) | 4652391..4654529 | + | 2139 | WP_002886904.1 | anaerobic ribonucleoside-triphosphate reductase | - |
| KP2022_RS22660 (4654770) | 4654770..4655234 | + | 465 | WP_047718307.1 | anaerobic ribonucleoside-triphosphate reductase-activating protein | - |
| KP2022_RS22665 (4655238) | 4655238..4655522 | - | 285 | WP_009309309.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
| KP2022_RS22670 (4655512) | 4655512..4655754 | - | 243 | WP_002886901.1 | type II toxin-antitoxin system RelB/DinJ family antitoxin | Antitoxin |
| KP2022_RS22675 (4655832) | 4655832..4657742 | - | 1911 | WP_004152270.1 | PRD domain-containing protein | - |
| KP2022_RS22680 (4657765) | 4657765..4658919 | - | 1155 | WP_047718309.1 | lactonase family protein | - |
| KP2022_RS22685 (4658986) | 4658986..4659726 | - | 741 | WP_002886899.1 | KDGP aldolase family protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 95 a.a. Molecular weight: 11141.99 Da Isoelectric Point: 10.3787
>T261896 WP_009309309.1 NZ_CP109604:c4655522-4655238 [Klebsiella pneumoniae]
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
MTYELEFDPRAWREWQKPGETVKKQFKNKLQQIVQNLRIESARLSDLPDCYKIKLKASGYRLVYQVRDSVVVVYVIAIGK
REKAAVYHQANKRL
Download Length: 285 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A085DK79 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0H3GLP0 |