Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
| Location | 4575193..4575884 | Replicon | chromosome |
| Accession | NZ_CP109604 | ||
| Organism | Klebsiella pneumoniae strain KP2022 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | - |
| Locus tag | KP2022_RS22335 | Protein ID | WP_129073948.1 |
| Coordinates | 4575193..4575534 (-) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yfjZ | Uniprot ID | A0A2A5MHA6 |
| Locus tag | KP2022_RS22340 | Protein ID | WP_019725272.1 |
| Coordinates | 4575558..4575884 (-) | Length | 109 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| KP2022_RS22300 (4570416) | 4570416..4570751 | - | 336 | WP_223366797.1 | hypothetical protein | - |
| KP2022_RS22305 (4570715) | 4570715..4571359 | - | 645 | WP_164972967.1 | hypothetical protein | - |
| KP2022_RS22310 (4571356) | 4571356..4572048 | - | 693 | WP_040173594.1 | HNH endonuclease signature motif containing protein | - |
| KP2022_RS22315 (4572245) | 4572245..4572827 | + | 583 | Protein_4375 | tyrosine-type recombinase/integrase | - |
| KP2022_RS22320 (4572983) | 4572983..4573876 | + | 894 | WP_040173596.1 | hypothetical protein | - |
| KP2022_RS22325 (4573955) | 4573955..4574239 | + | 285 | Protein_4377 | helix-turn-helix domain-containing protein | - |
| KP2022_RS22330 (4574245) | 4574245..4575078 | - | 834 | WP_040173641.1 | DUF4942 domain-containing protein | - |
| KP2022_RS22335 (4575193) | 4575193..4575534 | - | 342 | WP_129073948.1 | TA system toxin CbtA family protein | Toxin |
| KP2022_RS22340 (4575558) | 4575558..4575884 | - | 327 | WP_019725272.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| KP2022_RS22345 (4575898) | 4575898..4576374 | - | 477 | WP_019725273.1 | DNA repair protein RadC | - |
| KP2022_RS22350 (4576384) | 4576384..4576830 | - | 447 | WP_040173599.1 | antirestriction protein | - |
| KP2022_RS22355 (4577041) | 4577041..4577730 | - | 690 | WP_009309812.1 | hypothetical protein | - |
| KP2022_RS22360 (4578295) | 4578295..4579185 | - | 891 | WP_085163516.1 | YfjP family GTPase | - |
| KP2022_RS22365 (4579268) | 4579268..4580356 | - | 1089 | WP_085163515.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Genomic island | - | - | 4557653..4597048 | 39395 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12885.93 Da Isoelectric Point: 8.5195
>T261895 WP_129073948.1 NZ_CP109604:c4575534-4575193 [Klebsiella pneumoniae]
MKTLPATIQRAAKPCPSPVTVWQMLLTRLLEQHYGLTMNDTPFSDETVIQEHINAGITLVDAVNFLVEKYELVRIDRRGF
NCQEQSPYLGAVDILRARQATGLLRQRHLPSIR
MKTLPATIQRAAKPCPSPVTVWQMLLTRLLEQHYGLTMNDTPFSDETVIQEHINAGITLVDAVNFLVEKYELVRIDRRGF
NCQEQSPYLGAVDILRARQATGLLRQRHLPSIR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|