Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | kacAT/DUF1778(antitoxin) |
Location | 4529845..4530655 | Replicon | chromosome |
Accession | NZ_CP109604 | ||
Organism | Klebsiella pneumoniae strain KP2022 |
Toxin (Protein)
Gene name | KacT | Uniprot ID | A0A060VJ83 |
Locus tag | KP2022_RS22105 | Protein ID | WP_004178461.1 |
Coordinates | 4529845..4530378 (-) | Length | 178 a.a. |
Antitoxin (Protein)
Gene name | KacA | Uniprot ID | J2E9Q7 |
Locus tag | KP2022_RS22110 | Protein ID | WP_002887278.1 |
Coordinates | 4530389..4530655 (-) | Length | 89 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
KP2022_RS22100 (4528676) | 4528676..4529797 | + | 1122 | WP_101971391.1 | cupin domain-containing protein | - |
KP2022_RS22105 (4529845) | 4529845..4530378 | - | 534 | WP_004178461.1 | type II toxin-antitoxin system toxin KacT | Toxin |
KP2022_RS22110 (4530389) | 4530389..4530655 | - | 267 | WP_002887278.1 | type II toxin-antitoxin system antitoxin KacA | Antitoxin |
KP2022_RS22115 (4530758) | 4530758..4532191 | - | 1434 | WP_129073943.1 | Cu(+)/Ag(+) sensor histidine kinase | - |
KP2022_RS22120 (4532181) | 4532181..4532864 | - | 684 | WP_002887273.1 | copper response regulator transcription factor CusR | - |
KP2022_RS22125 (4533037) | 4533037..4534422 | + | 1386 | WP_029602902.1 | efflux transporter outer membrane subunit | - |
KP2022_RS22130 (4534440) | 4534440..4534745 | + | 306 | WP_032432083.1 | cation efflux system protein CusF | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 178 a.a. Molecular weight: 19810.65 Da Isoelectric Point: 5.2614
>T261894 WP_004178461.1 NZ_CP109604:c4530378-4529845 [Klebsiella pneumoniae]
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
MEQQLTIEMIADAFSYDITGFDCGEEALNTFLKEHLKRQHDGQILRGYALVSGDTVPRLLGYYTLSGSCFERGMLPSKTQ
QKKIPYQNAPSVTLGRLAIDKSVQGQGWGEMLVAHAMRVVWGASKAVGIYGLFVEALNEKAKAFYLRLGFIQLVDENSNL
LFYPTKSIEQLFTDDES
Download Length: 534 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A060VJ83 |
Antitoxin
Source | ID | Structure |
---|---|---|
PDB | 5ZGN | |
AlphaFold DB | A0A0H3GLZ1 |