Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) Hha-TomB/-
Location 3929680..3930299 Replicon chromosome
Accession NZ_CP109604
Organism Klebsiella pneumoniae strain KP2022

Toxin (Protein)


Gene name Hha Uniprot ID R8WYV2
Locus tag KP2022_RS19200 Protein ID WP_002892050.1
Coordinates 3930081..3930299 (+) Length 73 a.a.

Antitoxin (Protein)


Gene name TomB Uniprot ID J2DPF6
Locus tag KP2022_RS19195 Protein ID WP_002892066.1
Coordinates 3929680..3930054 (+) Length 125 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
KP2022_RS19185 (3924832) 3924832..3926025 + 1194 WP_004177236.1 multidrug efflux RND transporter periplasmic adaptor subunit AcrA -
KP2022_RS19190 (3926048) 3926048..3929194 + 3147 WP_004147373.1 multidrug efflux RND transporter permease subunit AcrB -
KP2022_RS19195 (3929680) 3929680..3930054 + 375 WP_002892066.1 Hha toxicity modulator TomB Antitoxin
KP2022_RS19200 (3930081) 3930081..3930299 + 219 WP_002892050.1 HHA domain-containing protein Toxin
KP2022_RS19205 (3930458) 3930458..3931024 + 567 WP_002892030.1 maltose O-acetyltransferase -
KP2022_RS19210 (3930996) 3930996..3931136 - 141 WP_004147370.1 hypothetical protein -
KP2022_RS19215 (3931157) 3931157..3931627 + 471 WP_002892026.1 YlaC family protein -
KP2022_RS19220 (3931602) 3931602..3933053 - 1452 WP_002892023.1 PLP-dependent aminotransferase family protein -
KP2022_RS19225 (3933154) 3933154..3933852 + 699 WP_040220001.1 GNAT family protein -
KP2022_RS19230 (3933849) 3933849..3933989 - 141 WP_040219999.1 type B 50S ribosomal protein L36 -
KP2022_RS19235 (3933989) 3933989..3934252 - 264 WP_264314091.1 type B 50S ribosomal protein L31 -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

Haemolysin expression modulating, HHA

(13-69)

Antitoxin

Biofilm formation regulator YbaJ

(1-116)


Sequences

Toxin        


Download         Length: 73 a.a.        Molecular weight: 8628.00 Da        Isoelectric Point: 8.9008

>T261893 WP_002892050.1 NZ_CP109604:3930081-3930299 [Klebsiella pneumoniae]
MSDKPLTKTDYLMRLRRCQTIDTLERVIEKNKYELSDNELAVFYSAADHRLAELTMNKLYDKIPTSVWKFIR

Download         Length: 219 bp

Antitoxin


Download         Length: 125 a.a.        Molecular weight: 14368.06 Da        Isoelectric Point: 4.8989

>AT261893 WP_002892066.1 NZ_CP109604:3929680-3930054 [Klebsiella pneumoniae]
MDEYSPKRHDIAQLRFLCETLYHDCLANLEESNHGWVNDPTSAVNLQLNELIEHIATFALNYKIKYAEDNKLIAQVDEYL
DDTFTLFSNYGINSTDLQKWKKSGNRLFRCFVNASRENPASLSC

Download         Length: 375 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2P8K6F2

Antitoxin

Source ID Structure
AlphaFold DB A0A0H3GJ93

References