Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumA-relB/upstrm_HI1419-dnstrm_HI1420 |
Location | 4944927..4945532 | Replicon | chromosome |
Accession | NZ_CP109603 | ||
Organism | Pseudomonas putida strain SEH01 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | OGV19_RS22315 | Protein ID | WP_264310671.1 |
Coordinates | 4945242..4945532 (-) | Length | 97 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OGV19_RS22310 | Protein ID | WP_264310670.1 |
Coordinates | 4944927..4945232 (-) | Length | 102 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGV19_RS22290 | 4941060..4943309 | + | 2250 | WP_264310667.1 | AsmA family protein | - |
OGV19_RS22295 | 4943306..4944373 | + | 1068 | WP_264310668.1 | A/G-specific adenine glycosylase | - |
OGV19_RS22300 | 4944370..4944642 | + | 273 | WP_264310669.1 | oxidative damage protection protein | - |
OGV19_RS22310 | 4944927..4945232 | - | 306 | WP_264310670.1 | putative addiction module antidote protein | Antitoxin |
OGV19_RS22315 | 4945242..4945532 | - | 291 | WP_264310671.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OGV19_RS22320 | 4945709..4946671 | + | 963 | WP_264310672.1 | polyphosphate kinase 2 | - |
OGV19_RS22325 | 4946681..4947214 | - | 534 | WP_264310673.1 | hypothetical protein | - |
OGV19_RS22330 | 4947344..4947787 | + | 444 | WP_027594262.1 | hypothetical protein | - |
OGV19_RS22335 | 4947960..4949345 | - | 1386 | WP_264310674.1 | GABA permease | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Prophage | - | - | 4938226..4979298 | 41072 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 97 a.a. Molecular weight: 10737.51 Da Isoelectric Point: 10.3650
>T261882 WP_264310671.1 NZ_CP109603:c4945532-4945242 [Pseudomonas putida]
MHILIQTETYKGWFAALRDARAQARINVRLRRIELGMLGDCKPVGEGVSEARINYGPGHRVYFVQRGYEVIILLAGGDKA
SQARDIKAALKLARDL
MHILIQTETYKGWFAALRDARAQARINVRLRRIELGMLGDCKPVGEGVSEARINYGPGHRVYFVQRGYEVIILLAGGDKA
SQARDIKAALKLARDL
Download Length: 291 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|