Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | relBE/ParE-YafN |
Location | 2980178..2980694 | Replicon | chromosome |
Accession | NZ_CP109603 | ||
Organism | Pseudomonas putida strain SEH01 |
Toxin (Protein)
Gene name | relE | Uniprot ID | - |
Locus tag | OGV19_RS13190 | Protein ID | WP_264313786.1 |
Coordinates | 2980178..2980459 (-) | Length | 94 a.a. |
Antitoxin (Protein)
Gene name | relB | Uniprot ID | - |
Locus tag | OGV19_RS13195 | Protein ID | WP_264313787.1 |
Coordinates | 2980449..2980694 (-) | Length | 82 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGV19_RS13170 | 2975677..2975856 | + | 180 | WP_264313782.1 | hypothetical protein | - |
OGV19_RS13175 | 2975860..2977269 | - | 1410 | WP_264313783.1 | amino acid permease | - |
OGV19_RS13180 | 2977596..2979020 | + | 1425 | WP_264313784.1 | PLP-dependent aminotransferase family protein | - |
OGV19_RS13185 | 2979201..2980121 | + | 921 | WP_264313785.1 | LysR family transcriptional regulator | - |
OGV19_RS13190 | 2980178..2980459 | - | 282 | WP_264313786.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OGV19_RS13195 | 2980449..2980694 | - | 246 | WP_264313787.1 | type II toxin-antitoxin system Phd/YefM family antitoxin | Antitoxin |
OGV19_RS13200 | 2980864..2981406 | + | 543 | WP_264313788.1 | WYL domain-containing protein | - |
OGV19_RS13205 | 2981420..2982154 | - | 735 | WP_264313938.1 | hypothetical protein | - |
OGV19_RS13210 | 2982504..2983127 | + | 624 | WP_264313789.1 | glutathione S-transferase | - |
OGV19_RS13215 | 2983274..2984038 | - | 765 | WP_264313790.1 | hypothetical protein | - |
OGV19_RS13220 | 2984210..2985391 | - | 1182 | WP_264313791.1 | MFS transporter | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 94 a.a. Molecular weight: 11005.92 Da Isoelectric Point: 10.9154
>T261879 WP_264313786.1 NZ_CP109603:c2980459-2980178 [Pseudomonas putida]
MTYKLEFLPSALKEWGKLGHTVREQVKKKLRERLQAPRVQADALRELPNHFKIKLKASGYRLIYRVEDERIVVVVVSIGK
RERSEVYDSAKRR
MTYKLEFLPSALKEWGKLGHTVREQVKKKLRERLQAPRVQADALRELPNHFKIKLKASGYRLIYRVEDERIVVVVVSIGK
RERSEVYDSAKRR
Download Length: 282 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|