Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | PumAB/upstrm_HI1419-DUF971 |
Location | 702244..702832 | Replicon | chromosome |
Accession | NZ_CP109603 | ||
Organism | Pseudomonas putida strain SEH01 |
Toxin (Protein)
Gene name | PumA | Uniprot ID | - |
Locus tag | OGV19_RS03140 | Protein ID | WP_264312093.1 |
Coordinates | 702530..702832 (-) | Length | 101 a.a. |
Antitoxin (Protein)
Gene name | PumB | Uniprot ID | - |
Locus tag | OGV19_RS03135 | Protein ID | WP_027593133.1 |
Coordinates | 702244..702537 (-) | Length | 98 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGV19_RS03115 | 697994..698929 | + | 936 | WP_264312089.1 | AEC family transporter | - |
OGV19_RS03120 | 699050..700336 | - | 1287 | WP_264312090.1 | mechanosensitive ion channel family protein | - |
OGV19_RS03125 | 700441..701802 | + | 1362 | WP_264312091.1 | DEAD/DEAH box helicase | - |
OGV19_RS03130 | 701859..702131 | - | 273 | WP_264312092.1 | hypothetical protein | - |
OGV19_RS03135 | 702244..702537 | - | 294 | WP_027593133.1 | putative addiction module antidote protein | Antitoxin |
OGV19_RS03140 | 702530..702832 | - | 303 | WP_264312093.1 | type II toxin-antitoxin system RelE/ParE family toxin | Toxin |
OGV19_RS03145 | 702963..703358 | + | 396 | WP_264312094.1 | transcriptional regulator | - |
OGV19_RS03150 | 703465..704391 | + | 927 | WP_264312095.1 | DMT family transporter | - |
OGV19_RS03155 | 704401..705582 | - | 1182 | WP_264312096.1 | MFS transporter | - |
OGV19_RS03160 | 705689..706582 | + | 894 | WP_264312097.1 | LysR family transcriptional regulator | - |
OGV19_RS03165 | 706707..706835 | + | 129 | WP_256214945.1 | PA1414 family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 101 a.a. Molecular weight: 11428.13 Da Isoelectric Point: 10.5383
>T261877 WP_264312093.1 NZ_CP109603:c702832-702530 [Pseudomonas putida]
MKKIESSSFRHWVHGLRDEMARIRIIARINRLMEGLPGDVSAVGHGVSELRVHHGPGYRVYFHQAGDTLVILLCGGDKSS
QRRDIKAAHEILRSWRMQND
MKKIESSSFRHWVHGLRDEMARIRIIARINRLMEGLPGDVSAVGHGVSELRVHHGPGYRVYFHQAGDTLVILLCGGDKSS
QRRDIKAAHEILRSWRMQND
Download Length: 303 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|