Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | hicAB/HicA-HicB |
Location | 22419..23050 | Replicon | chromosome |
Accession | NZ_CP109603 | ||
Organism | Pseudomonas putida strain SEH01 |
Toxin (Protein)
Gene name | hicA | Uniprot ID | - |
Locus tag | OGV19_RS00090 | Protein ID | WP_264311566.1 |
Coordinates | 22419..22643 (+) | Length | 75 a.a. |
Antitoxin (Protein)
Gene name | hicB | Uniprot ID | - |
Locus tag | OGV19_RS00095 | Protein ID | WP_264311567.1 |
Coordinates | 22643..23050 (+) | Length | 136 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGV19_RS00065 | 17550..18041 | + | 492 | WP_264311562.1 | OmpA family protein | - |
OGV19_RS00070 | 18174..19124 | - | 951 | WP_264311563.1 | LysR family transcriptional regulator | - |
OGV19_RS00075 | 19257..20783 | + | 1527 | WP_264311564.1 | CoA-acylating methylmalonate-semialdehyde dehydrogenase | - |
OGV19_RS00080 | 20794..21681 | + | 888 | WP_264311565.1 | 3-hydroxyisobutyrate dehydrogenase | - |
OGV19_RS00085 | 21791..22135 | - | 345 | WP_003251579.1 | cupin domain-containing protein | - |
OGV19_RS00090 | 22419..22643 | + | 225 | WP_264311566.1 | type II toxin-antitoxin system HicA family toxin | Toxin |
OGV19_RS00095 | 22643..23050 | + | 408 | WP_264311567.1 | type II toxin-antitoxin system HicB family antitoxin | Antitoxin |
OGV19_RS00100 | 23083..24015 | - | 933 | WP_027595453.1 | phosphatidate cytidylyltransferase | - |
OGV19_RS00105 | 24017..24640 | - | 624 | WP_264311568.1 | lysophospholipid acyltransferase family protein | - |
OGV19_RS00110 | 24651..25082 | - | 432 | WP_264311569.1 | hypothetical protein | - |
OGV19_RS00115 | 25079..26401 | - | 1323 | WP_264311570.1 | phosphatase PAP2/dual specificity phosphatase family protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 75 a.a. Molecular weight: 8243.39 Da Isoelectric Point: 10.8123
>T261875 WP_264311566.1 NZ_CP109603:22419-22643 [Pseudomonas putida]
VRSREVIQIIEADGWYEVEVKGSHHQFRHPVKRGRVTVPHPKSDLPKGTVHNILKQAGLKQPSSPSSSIIRGDA
VRSREVIQIIEADGWYEVEVKGSHHQFRHPVKRGRVTVPHPKSDLPKGTVHNILKQAGLKQPSSPSSSIIRGDA
Download Length: 225 bp
Antitoxin
Download Length: 136 a.a. Molecular weight: 14697.50 Da Isoelectric Point: 4.8984
>AT261875 WP_264311567.1 NZ_CP109603:22643-23050 [Pseudomonas putida]
MKFPVVLHKDADSDYGVTVPDVPGCFSAGASVSQALENIQEALALHFEGLVADNEALPQAQEIDVHVANPDYHGGVWAVV
DFDVTPYLGKAVRFNATLPENLLQRIDEKVKRDHRYASRSGFLASAALRELASVH
MKFPVVLHKDADSDYGVTVPDVPGCFSAGASVSQALENIQEALALHFEGLVADNEALPQAQEIDVHVANPDYHGGVWAVV
DFDVTPYLGKAVRFNATLPENLLQRIDEKVKRDHRYASRSGFLASAALRELASVH
Download Length: 408 bp
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|