Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | vapBC/VapC-VagC |
Location | 54627..55252 | Replicon | plasmid p1 |
Accession | NZ_CP109602 | ||
Organism | Escherichia coli strain TL-14 |
Toxin (Protein)
Gene name | vapC | Uniprot ID | - |
Locus tag | OGV15_RS23490 | Protein ID | WP_000911313.1 |
Coordinates | 54854..55252 (+) | Length | 133 a.a. |
Antitoxin (Protein)
Gene name | vapB | Uniprot ID | V0VCB2 |
Locus tag | OGV15_RS23485 | Protein ID | WP_000450520.1 |
Coordinates | 54627..54854 (+) | Length | 76 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGV15_RS23485 (54627) | 54627..54854 | + | 228 | WP_000450520.1 | toxin-antitoxin system antitoxin VapB | Antitoxin |
OGV15_RS23490 (54854) | 54854..55252 | + | 399 | WP_000911313.1 | type II toxin-antitoxin system VapC family toxin | Toxin |
OGV15_RS23495 (55261) | 55261..57414 | - | 2154 | WP_000009324.1 | type IV conjugative transfer system coupling protein TraD | - |
OGV15_RS23500 (57667) | 57667..58398 | - | 732 | WP_023565183.1 | conjugal transfer complement resistance protein TraT | - |
OGV15_RS23505 (58430) | 58430..58927 | - | 498 | WP_000605859.1 | entry exclusion protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Conjugative plasmid | blaTEM-1B / tet(B) / aph(3'')-Ib / aph(6)-Id | espP / faeJ / faeI / faeH / faeF / faeE / faeD / faeC | 1..145661 | 145661 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 133 a.a. Molecular weight: 14901.15 Da Isoelectric Point: 7.8605
>T261871 WP_000911313.1 NZ_CP109602:54854-55252 [Escherichia coli]
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
MLKFMLDTNICIFTIKNKPASVRERFNLNQGRMCISSVTLMELIYGAEKSQMPERNLAVIEGFVSRIDVLDYDAAAATHS
GQIRAELARQGRPVGPFDQMIAGHARSRGLIIVTNNTREFERVDGLRIEDWS
Download Length: 399 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|