261853

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 1825859..1826690 Replicon chromosome
Accession NZ_CP109601
Organism Escherichia coli strain TL-14

Toxin (Protein)


Gene name yeeV Uniprot ID F4THW6
Locus tag OGV15_RS08680 Protein ID WP_000854818.1
Coordinates 1825859..1826233 (-) Length 125 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID F4THW5
Locus tag OGV15_RS08685 Protein ID WP_001313071.1
Coordinates 1826322..1826690 (-) Length 123 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OGV15_RS08640 (1821253) 1821253..1822421 + 1169 Protein_1687 serine-type D-Ala-D-Ala carboxypeptidase DacD -
OGV15_RS08645 (1822540) 1822540..1823013 + 474 WP_001105393.1 DNA gyrase inhibitor SbmC -
OGV15_RS08650 (1823211) 1823211..1824269 + 1059 WP_001200905.1 FUSC family protein -
OGV15_RS08655 (1824441) 1824441..1824770 + 330 WP_000450409.1 DUF496 family protein -
OGV15_RS08660 (1824871) 1824871..1825005 - 135 WP_001297944.1 EutP/PduV family microcompartment system protein -
OGV15_RS08665 (1825107) 1825107..1825253 + 147 Protein_1692 transposase domain-containing protein -
OGV15_RS08670 (1825542) 1825542..1825622 - 81 Protein_1693 hypothetical protein -
OGV15_RS08675 (1825668) 1825668..1825862 - 195 WP_000988600.1 DUF5983 family protein -
OGV15_RS08680 (1825859) 1825859..1826233 - 375 WP_000854818.1 type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA Toxin
OGV15_RS08685 (1826322) 1826322..1826690 - 369 WP_001313071.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
OGV15_RS08690 (1826770) 1826770..1826991 - 222 WP_000692301.1 DUF987 domain-containing protein -
OGV15_RS08695 (1827054) 1827054..1827530 - 477 WP_001186726.1 RadC family protein -
OGV15_RS08700 (1827546) 1827546..1828025 - 480 WP_000860076.1 antirestriction protein -
OGV15_RS08705 (1828107) 1828107..1828928 - 822 WP_001234530.1 DUF932 domain-containing protein -
OGV15_RS08710 (1829149) 1829149..1829559 - 411 WP_000846713.1 hypothetical protein -
OGV15_RS08715 (1829575) 1829575..1830258 - 684 WP_042004735.1 hypothetical protein -
OGV15_RS08720 (1830394) 1830394..1831464 - 1071 WP_000102643.1 patatin-like phospholipase family protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(18-117)


Sequences

Toxin        


Download         Length: 125 a.a.        Molecular weight: 13972.98 Da        Isoelectric Point: 7.1333

>T261853 WP_000854818.1 NZ_CP109601:c1826233-1825859 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIEAGISLCDAVNFLVEKYALVRTDQPEF
SACTRSQLINSIDILRARRATGLMTRDNYRTVNNITLGKYPEAK

Download         Length: 375 bp

Antitoxin


Download         Length: 123 a.a.        Molecular weight: 13498.23 Da        Isoelectric Point: 5.8696

>AT261853 WP_001313071.1 NZ_CP109601:c1826690-1826322 [Escherichia coli]
VSDTLSGTTHPDDNNSHPWWGLPCTVTPCFGACLVQEGNRLHYLADRAGIRGRFSDADAYHLDQAFPLLMKQLELMLTSG
ELNPRHQHTVTLYAKGLTCEADTLGSCGYVYLAVYPTPEMKN

Download         Length: 369 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A3W3PHA3

Antitoxin

Source ID Structure
AlphaFold DB A0A1M1L2Z3

References