Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | mazEF/PRK09907-MazE |
Location | 1026035..1026618 | Replicon | chromosome |
Accession | NZ_CP109601 | ||
Organism | Escherichia coli strain TL-14 |
Toxin (Protein)
Gene name | mazF | Uniprot ID | - |
Locus tag | OGV15_RS04980 | Protein ID | WP_049253269.1 |
Coordinates | 1026283..1026618 (+) | Length | 112 a.a. |
Antitoxin (Protein)
Gene name | mazE | Uniprot ID | A0A1V2T5M9 |
Locus tag | OGV15_RS04975 | Protein ID | WP_000581941.1 |
Coordinates | 1026035..1026283 (+) | Length | 83 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OGV15_RS04965 (1022374) | 1022374..1023675 | + | 1302 | WP_023281448.1 | 23S rRNA (uracil(1939)-C(5))-methyltransferase RlmD | - |
OGV15_RS04970 (1023723) | 1023723..1025957 | + | 2235 | WP_000226815.1 | GTP pyrophosphokinase | - |
OGV15_RS04975 (1026035) | 1026035..1026283 | + | 249 | WP_000581941.1 | type II toxin-antitoxin system antitoxin MazE | Antitoxin |
OGV15_RS04980 (1026283) | 1026283..1026618 | + | 336 | WP_049253269.1 | endoribonuclease MazF | Toxin |
OGV15_RS04985 (1026689) | 1026689..1027480 | + | 792 | WP_001071648.1 | nucleoside triphosphate pyrophosphohydrolase | - |
OGV15_RS04990 (1027708) | 1027708..1029346 | + | 1639 | Protein_977 | CTP synthase (glutamine hydrolyzing) | - |
OGV15_RS04995 (1029434) | 1029434..1030732 | + | 1299 | WP_000036723.1 | phosphopyruvate hydratase | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 112 a.a. Molecular weight: 12197.18 Da Isoelectric Point: 8.7218
>T261851 WP_049253269.1 NZ_CP109601:1026283-1026618 [Escherichia coli]
MVSRYVPDMGDLIWVDFDPTKGSEQARHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
MVSRYVPDMGDLIWVDFDPTKGSEQARHRPAVVLSPFMYNNKTGMCLCVPCTTQSKGYPFEVVLSGQERDGVALADQVKS
IAWRARGATKKGTVAPEELQLIKAKINVLIG
Download Length: 336 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|