Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yeeUV (cbtA-cbeA)/CbtA-CbeA |
| Location | 46608..47443 | Replicon | chromosome |
| Accession | NZ_CP109601 | ||
| Organism | Escherichia coli strain TL-14 | ||
Toxin (Protein)
| Gene name | yeeV | Uniprot ID | A0A8E0IXC7 |
| Locus tag | OGV15_RS00245 | Protein ID | WP_000854824.1 |
| Coordinates | 46608..46985 (-) | Length | 126 a.a. |
Antitoxin (Protein)
| Gene name | yeeU | Uniprot ID | B7MK11 |
| Locus tag | OGV15_RS00250 | Protein ID | WP_001285610.1 |
| Coordinates | 47075..47443 (-) | Length | 123 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OGV15_RS00215 (42226) | 42226..43410 | - | 1185 | WP_001172876.1 | sugar efflux transporter | - |
| OGV15_RS00220 (43807) | 43807..43968 | - | 162 | Protein_43 | virulence RhuM family protein | - |
| OGV15_RS00225 (44241) | 44241..44938 | + | 698 | WP_151884388.1 | IS1 family transposase | - |
| OGV15_RS00230 (44982) | 44982..45824 | - | 843 | WP_001290169.1 | DUF4942 domain-containing protein | - |
| OGV15_RS00235 (45909) | 45909..46106 | - | 198 | WP_000839265.1 | DUF957 domain-containing protein | - |
| OGV15_RS00240 (46123) | 46123..46611 | - | 489 | WP_000761682.1 | DUF5983 family protein | - |
| OGV15_RS00245 (46608) | 46608..46985 | - | 378 | WP_000854824.1 | type IV toxin-antitoxin system cytoskeleton-binding toxin CbtA | Toxin |
| OGV15_RS00250 (47075) | 47075..47443 | - | 369 | WP_001285610.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
| OGV15_RS00255 (47523) | 47523..47744 | - | 222 | WP_000692350.1 | DUF987 domain-containing protein | - |
| OGV15_RS00260 (47831) | 47831..48307 | - | 477 | WP_124047491.1 | RadC family protein | - |
| OGV15_RS00265 (48322) | 48322..48801 | - | 480 | WP_000706975.1 | antirestriction protein | - |
| OGV15_RS00270 (49067) | 49067..49885 | - | 819 | WP_001175165.1 | DUF932 domain-containing protein | - |
| OGV15_RS00275 (49975) | 49975..50208 | - | 234 | WP_001278293.1 | DUF905 family protein | - |
| OGV15_RS00280 (50214) | 50214..50891 | - | 678 | WP_001097302.1 | hypothetical protein | - |
| OGV15_RS00285 (51039) | 51039..51719 | - | 681 | WP_001282921.1 | WYL domain-containing protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 126 a.a. Molecular weight: 13930.95 Da Isoelectric Point: 8.5163
>T261846 WP_000854824.1 NZ_CP109601:c46985-46608 [Escherichia coli]
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIETGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
MKTLPVLPGQAASSRPSPVEIWQTLLTRLLDQHYGLTLNDTPFADERVIEQHIETGISLCDAVNFLVEKYALVRTDQPGF
SACTRSQLINSIDILRARRATGLMARDNYRTVNNITLGKHPGAKQ
Download Length: 378 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|
Antitoxin
| Source | ID | Structure |
|---|