261836

Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type IV Classification (family/domain) yeeUV (cbtA-cbeA)/CbtA-CbeA
Location 4021742..4022529 Replicon chromosome
Accession NZ_CP107720
Organism Escherichia coli strain 2021CK-01361

Toxin (Protein)


Gene name yeeV Uniprot ID A0A2H9G3C1
Locus tag N4T39_RS19840 Protein ID WP_001568519.1
Coordinates 4022152..4022529 (+) Length 126 a.a.

Antitoxin (Protein)


Gene name yeeU Uniprot ID A0A2H9G3E7
Locus tag N4T39_RS19835 Protein ID WP_000066236.1
Coordinates 4021742..4022101 (+) Length 120 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
N4T39_RS19795 (4017438) 4017438..4017584 + 147 WP_023563913.1 hypothetical protein -
N4T39_RS19800 (4017597) 4017597..4017812 + 216 WP_041036768.1 hypothetical protein -
N4T39_RS19805 (4017926) 4017926..4018336 + 411 WP_042851426.1 hypothetical protein -
N4T39_RS19810 (4018510) 4018510..4019340 + 831 WP_228337380.1 hypothetical protein -
N4T39_RS19815 (4019429) 4019429..4020247 + 819 WP_016236913.1 DUF932 domain-containing protein -
N4T39_RS19820 (4020515) 4020515..4020985 + 471 WP_000131762.1 antirestriction protein -
N4T39_RS19825 (4020997) 4020997..4021476 + 480 WP_000437750.1 DNA repair protein RadC -
N4T39_RS19830 (4021497) 4021497..4021718 + 222 WP_000691981.1 DUF987 domain-containing protein -
N4T39_RS19835 (4021742) 4021742..4022101 + 360 WP_000066236.1 type IV toxin-antitoxin system YeeU family antitoxin Antitoxin
N4T39_RS19840 (4022152) 4022152..4022529 + 378 WP_001568519.1 TA system toxin CbtA family protein Toxin
N4T39_RS19845 (4022526) 4022526..4023017 + 492 WP_000777682.1 DUF5983 family protein -
N4T39_RS19850 (4023049) 4023049..4023252 + 204 WP_000413747.1 DUF957 domain-containing protein -
N4T39_RS19855 (4023333) 4023333..4024178 + 846 WP_016236912.1 DUF4942 domain-containing protein -
N4T39_RS19865 (4024520) 4024520..4025251 - 732 WP_001300756.1 DNA polymerase III subunit epsilon -
N4T39_RS19870 (4025316) 4025316..4025783 + 468 WP_000917883.1 ribonuclease HI -
N4T39_RS19875 (4025780) 4025780..4026502 - 723 WP_001295200.1 class I SAM-dependent methyltransferase -
N4T39_RS19880 (4026536) 4026536..4027291 + 756 WP_001052721.1 hydroxyacylglutathione hydrolase -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)
- inside Genomic island - - 4017597..4027291 9694


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

CbtA toxin of type IV toxin-antitoxin system

(1-112)

Antitoxin

Antitoxin CbeA

(15-114)


Sequences

Toxin        


Download         Length: 126 a.a.        Molecular weight: 14211.00 Da        Isoelectric Point: 7.4209

>T261836 WP_001568519.1 NZ_CP107720:4022152-4022529 [Escherichia coli]
MQTQPLSSTQEATSRPSPVEIWQRLLSHLLDRHYGLTLNDTPFGNDGVIQEHIDAGISLCDAVNFIVEKYDLVRIDRHGF
STETQLPRLTSIDILRARKTTGLMTRNDYRTVTDITTGKYRGGHR

Download         Length: 378 bp

Antitoxin


Download         Length: 120 a.a.        Molecular weight: 13127.02 Da        Isoelectric Point: 7.0261

>AT261836 WP_000066236.1 NZ_CP107720:4021742-4022101 [Escherichia coli]
MSNKIPTVNHDITEPWWGLKRSITPCFGARLVQSGNCLHYLADRASITGQFSDGDLRHLDQAFPLLLKQLELMLTSGELT
PRHQHCVTLYAKGLTCEADSLGSHGYVYLAIYPTPAATA

Download         Length: 360 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A2H9G3C1

Antitoxin

Source ID Structure
AlphaFold DB A0A2H9G3E7

References