Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | yafW-ykfI/CbtA-CbeA |
| Location | 3828942..3829621 | Replicon | chromosome |
| Accession | NZ_CP107720 | ||
| Organism | Escherichia coli strain 2021CK-01361 | ||
Toxin (Protein)
| Gene name | ykfI | Uniprot ID | S1FHS4 |
| Locus tag | N4T39_RS18695 | Protein ID | WP_000854680.1 |
| Coordinates | 3829280..3829621 (+) | Length | 114 a.a. |
Antitoxin (Protein)
| Gene name | yafW | Uniprot ID | S1EWR7 |
| Locus tag | N4T39_RS18690 | Protein ID | WP_000070396.1 |
| Coordinates | 3828942..3829259 (+) | Length | 106 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| N4T39_RS18645 (3824380) | 3824380..3825201 | + | 822 | WP_000197388.1 | DUF932 domain-containing protein | - |
| N4T39_RS18650 (3825418) | 3825418..3826119 | + | 702 | WP_060616110.1 | WYL domain-containing protein | - |
| N4T39_RS18655 (3826160) | 3826160..3826396 | + | 237 | WP_001144031.1 | protein YpjK | - |
| N4T39_RS18660 (3826396) | 3826396..3826839 | + | 444 | WP_000649865.1 | hypothetical protein | - |
| N4T39_RS18665 (3826862) | 3826862..3827329 | + | 468 | WP_001385283.1 | protein YkfB | - |
| N4T39_RS18670 (3827406) | 3827406..3827645 | + | 240 | WP_000194654.1 | DUF905 family protein | - |
| N4T39_RS18675 (3827743) | 3827743..3828201 | + | 459 | WP_000211838.1 | antirestriction protein | - |
| N4T39_RS18680 (3828217) | 3828217..3828693 | + | 477 | WP_001549015.1 | RadC family protein | - |
| N4T39_RS18685 (3828702) | 3828702..3828923 | + | 222 | WP_000691994.1 | DUF987 domain-containing protein | - |
| N4T39_RS18690 (3828942) | 3828942..3829259 | + | 318 | WP_000070396.1 | type IV toxin-antitoxin system antitoxin YafW | Antitoxin |
| N4T39_RS18695 (3829280) | 3829280..3829621 | + | 342 | WP_000854680.1 | type IV toxin-antitoxin system toxin YkfI | Toxin |
| N4T39_RS18700 (3830540) | 3830540..3831778 | + | 1239 | WP_000219087.1 | IS110-like element ISEsa2 family transposase | - |
| N4T39_RS18705 (3831935) | 3831935..3833401 | - | 1467 | WP_000723924.1 | hypothetical protein | - |
| N4T39_RS18710 (3833717) | 3833717..3834106 | - | 390 | WP_223596848.1 | hypothetical protein | - |
| N4T39_RS18715 (3834350) | 3834350..3834436 | - | 87 | Protein_3670 | capsid protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12892.95 Da Isoelectric Point: 9.6543
>T261835 WP_000854680.1 NZ_CP107720:3829280-3829621 [Escherichia coli]
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
MKTLPATTQRAVKPCLSPVAVWQMLLTRLLEQHYGLTINDTPFCNEAVIKEHIDAGITLADAVNFLVEKYELVRIDRKGF
SWQEQSPYLRAADILRARQATGLLRQSRNNVVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|