Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | IV | Classification (family/domain) | ykfI-yfjZ/CbtA-CbeA |
Location | 52122..52802 | Replicon | chromosome |
Accession | NZ_CP107720 | ||
Organism | Escherichia coli strain 2021CK-01361 |
Toxin (Protein)
Gene name | ykfI | Uniprot ID | - |
Locus tag | N4T39_RS00260 | Protein ID | WP_039026306.1 |
Coordinates | 52122..52463 (-) | Length | 114 a.a. |
Antitoxin (Protein)
Gene name | yfjZ | Uniprot ID | - |
Locus tag | N4T39_RS00265 | Protein ID | WP_039026307.1 |
Coordinates | 52485..52802 (-) | Length | 106 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
N4T39_RS00235 (47602) | 47602..47763 | - | 162 | Protein_46 | virulence RhuM family protein | - |
N4T39_RS00245 (49608) | 49608..49811 | - | 204 | Protein_48 | winged helix-turn-helix domain-containing protein | - |
N4T39_RS00250 (49810) | 49810..50652 | - | 843 | Protein_49 | integrase arm-type DNA-binding domain-containing protein | - |
N4T39_RS00255 (51173) | 51173..52006 | - | 834 | WP_039026305.1 | DUF4942 domain-containing protein | - |
N4T39_RS00260 (52122) | 52122..52463 | - | 342 | WP_039026306.1 | TA system toxin CbtA family protein | Toxin |
N4T39_RS00265 (52485) | 52485..52802 | - | 318 | WP_039026307.1 | type IV toxin-antitoxin system YeeU family antitoxin | Antitoxin |
N4T39_RS00270 (52820) | 52820..53041 | - | 222 | WP_000691995.1 | DUF987 domain-containing protein | - |
N4T39_RS00275 (53050) | 53050..53526 | - | 477 | WP_039026308.1 | RadC family protein | - |
N4T39_RS00280 (53542) | 53542..54000 | - | 459 | WP_039026309.1 | antirestriction protein | - |
N4T39_RS00285 (54115) | 54115..54339 | - | 225 | WP_039026310.1 | DUF905 domain-containing protein | - |
N4T39_RS00290 (54435) | 54435..55310 | - | 876 | WP_176393125.1 | Ivy family c-type lysozyme inhibitor | - |
N4T39_RS00295 (55421) | 55421..55636 | - | 216 | WP_039026311.1 | hypothetical protein | - |
N4T39_RS00300 (55964) | 55964..56661 | - | 698 | Protein_59 | DeoR family transcriptional regulator | - |
N4T39_RS00305 (56870) | 56870..57694 | - | 825 | WP_039026313.1 | DUF932 domain-containing protein | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 114 a.a. Molecular weight: 12825.82 Da Isoelectric Point: 9.7153
>T261815 WP_039026306.1 NZ_CP107720:c52463-52122 [Escherichia coli]
MKTLPATISRAAKPCLSTVAVWQMLLTRLLEQHYGLTLNDTPFSDVTVIQEHINAGITLADAVNFLVEKYELVRIDRRSF
NCQEQSPYIRAVDILRARQATGLLRQSRNNAVR
MKTLPATISRAAKPCLSTVAVWQMLLTRLLEQHYGLTLNDTPFSDVTVIQEHINAGITLADAVNFLVEKYELVRIDRRSF
NCQEQSPYIRAVDILRARQATGLLRQSRNNAVR
Download Length: 342 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|
Antitoxin
Source | ID | Structure |
---|