Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | unclassified/Polyketide_cyc2(toxin) |
Location | 1313438..1314070 | Replicon | chromosome |
Accession | NZ_CP107719 | ||
Organism | Mycolicibacterium fortuitum strain MF GZ001 |
Toxin (Protein)
Gene name | novel[antitoxin] | Uniprot ID | - |
Locus tag | OF855_RS06135 | Protein ID | WP_003881879.1 |
Coordinates | 1313621..1314070 (+) | Length | 150 a.a. |
Antitoxin (Protein)
Gene name | novel[toxin] | Uniprot ID | A0A100WWS2 |
Locus tag | OF855_RS06130 | Protein ID | WP_054601330.1 |
Coordinates | 1313438..1313617 (+) | Length | 60 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OF855_RS06115 (OF855_06120) | 1308977..1309711 | + | 735 | WP_003881875.1 | enoyl-CoA hydratase | - |
OF855_RS06120 (OF855_06125) | 1309713..1310819 | + | 1107 | WP_269976420.1 | MBL fold metallo-hydrolase | - |
OF855_RS06125 (OF855_06130) | 1310886..1313378 | + | 2493 | WP_269976421.1 | cation-translocating P-type ATPase | - |
OF855_RS06130 (OF855_06135) | 1313438..1313617 | + | 180 | WP_054601330.1 | antitoxin | Antitoxin |
OF855_RS06135 (OF855_06140) | 1313621..1314070 | + | 450 | WP_003881879.1 | SRPBCC family protein | Toxin |
OF855_RS06140 (OF855_06145) | 1314074..1314502 | - | 429 | WP_061265375.1 | hypothetical protein | - |
OF855_RS06145 (OF855_06150) | 1314522..1315223 | - | 702 | WP_003881881.1 | hypothetical protein | - |
OF855_RS06150 (OF855_06155) | 1315220..1315351 | - | 132 | WP_003881882.1 | hypothetical protein | - |
OF855_RS06155 (OF855_06160) | 1315367..1316167 | - | 801 | WP_065069857.1 | CbbQ/NirQ/NorQ/GpvN family protein | - |
OF855_RS06160 (OF855_06165) | 1316164..1317693 | - | 1530 | WP_269976760.1 | MorD protein | - |
OF855_RS06165 (OF855_06170) | 1317845..1318447 | - | 603 | WP_061265372.1 | TetR/AcrR family transcriptional regulator | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 150 a.a. Molecular weight: 16117.67 Da Isoelectric Point: 9.6573
>T261813 WP_003881879.1 NZ_CP107719:1313621-1314070 [Mycolicibacterium fortuitum]
MAKLSVSVEVPLPPEKAWEYASDLSRYDEWLSIHRAWRSKLPETLEKGTVIDSIVEVKGMLNRVKWTLVNYKPPQSLTLN
GDGRGGVKVKLIGKITPAAVDGGDGAKVSFDVHLGGPALFGPIGMVVAAALKGDIQQSLNKFKELYASS
MAKLSVSVEVPLPPEKAWEYASDLSRYDEWLSIHRAWRSKLPETLEKGTVIDSIVEVKGMLNRVKWTLVNYKPPQSLTLN
GDGRGGVKVKLIGKITPAAVDGGDGAKVSFDVHLGGPALFGPIGMVVAAALKGDIQQSLNKFKELYASS
Download Length: 450 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|