Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | tacAT/DUF1778(antitoxin) |
Location | 1279206..1279984 | Replicon | chromosome |
Accession | NZ_CP107717 | ||
Organism | Xanthomonas campestris pv. campestris strain XY1-1 |
Toxin (Protein)
Gene name | TacT2 | Uniprot ID | Q8P667 |
Locus tag | OF401_RS05360 | Protein ID | WP_011038220.1 |
Coordinates | 1279206..1279697 (-) | Length | 164 a.a. |
Antitoxin (Protein)
Gene name | TacA2 | Uniprot ID | Q8P668 |
Locus tag | OF401_RS05365 | Protein ID | WP_011038219.1 |
Coordinates | 1279694..1279984 (-) | Length | 97 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OF401_RS05345 (OF401_05345) | 1275534..1276409 | + | 876 | WP_016945000.1 | 30S ribosomal protein S6--L-glutamate ligase | - |
OF401_RS05350 (OF401_05350) | 1277059..1277736 | + | 678 | WP_003490678.1 | response regulator transcription factor | - |
OF401_RS05355 (OF401_05355) | 1277729..1279063 | + | 1335 | WP_057671653.1 | HAMP domain-containing sensor histidine kinase | - |
OF401_RS05360 (OF401_05360) | 1279206..1279697 | - | 492 | WP_011038220.1 | GNAT family N-acetyltransferase | Toxin |
OF401_RS05365 (OF401_05365) | 1279694..1279984 | - | 291 | WP_011038219.1 | DUF1778 domain-containing protein | Antitoxin |
OF401_RS05370 (OF401_05370) | 1280059..1280460 | - | 402 | WP_040940795.1 | SymE family type I addiction module toxin | - |
OF401_RS05375 (OF401_05375) | 1280992..1281615 | - | 624 | WP_011038217.1 | dephospho-CoA kinase | - |
OF401_RS05380 (OF401_05380) | 1281629..1282492 | - | 864 | WP_057671659.1 | A24 family peptidase | - |
OF401_RS05385 (OF401_05385) | 1282499..1283761 | - | 1263 | WP_057671824.1 | type II secretion system F family protein | - |
OF401_RS05390 (OF401_05390) | 1284103..1284531 | + | 429 | WP_057671660.1 | pilin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Genomic island | - | - | 1237246..1293152 | 55906 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 164 a.a. Molecular weight: 17638.31 Da Isoelectric Point: 8.1192
>T261811 WP_011038220.1 NZ_CP107717:c1279697-1279206 [Xanthomonas campestris pv. campestris]
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
MTVSAPEPLTAHHRVEPFASGVESLDHWLKRRALKNQATGASRTFVACEDDRVVAYYALASSAVAVDATPGRFRRNMPDP
IPVVVLGRLAVDQSLHGRGFGRALMQDAGKRILHAADTIGIRGLLVHALSADAKAFYERIGFEPSPLDPMVLVVTLEDLK
ASL
Download Length: 492 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|