Detailed information of TA system    

insolicoBioinformatically predicted

Overview

TA module


Type II Classification (family/domain) hicAB/HicA-HicB
Location 2618631..2619282 Replicon chromosome
Accession NZ_CP107616
Organism Acinetobacter baumannii strain 1326932

Toxin (Protein)


Gene name hicA Uniprot ID A0A5Q0RPK1
Locus tag OIO62_RS12415 Protein ID WP_000838147.1
Coordinates 2619100..2619282 (-) Length 61 a.a.

Antitoxin (Protein)


Gene name hicB Uniprot ID A0A335N5K1
Locus tag OIO62_RS12410 Protein ID WP_000966690.1
Coordinates 2618631..2619035 (-) Length 135 a.a.

Genomic Context

Locus tag Coordinates Strand Size (bp) Protein ID Product Description
OIO62_RS12390 (OIO62_12390) 2617044..2617445 - 402 WP_000758222.1 hypothetical protein -
OIO62_RS12395 (OIO62_12395) 2617457..2617990 - 534 WP_000719143.1 hypothetical protein -
OIO62_RS12400 (OIO62_12400) 2618024..2618347 - 324 WP_000523922.1 DUF4236 domain-containing protein -
OIO62_RS12405 (OIO62_12405) 2618356..2618532 - 177 WP_001983384.1 hypothetical protein -
OIO62_RS12410 (OIO62_12410) 2618631..2619035 - 405 WP_000966690.1 type II toxin-antitoxin system HicB family antitoxin Antitoxin
OIO62_RS12415 (OIO62_12415) 2619100..2619282 - 183 WP_000838147.1 type II toxin-antitoxin system HicA family toxin Toxin
OIO62_RS12420 (OIO62_12420) 2619351..2619611 - 261 WP_074163942.1 hypothetical protein -
OIO62_RS12425 (OIO62_12425) 2619614..2620147 - 534 WP_001185621.1 hypothetical protein -
OIO62_RS12430 (OIO62_12430) 2620195..2621124 - 930 WP_000094301.1 phage tail tube protein -
OIO62_RS12435 (OIO62_12435) 2621232..2621444 - 213 WP_001983388.1 hypothetical protein -
OIO62_RS12440 (OIO62_12440) 2621446..2621844 - 399 WP_001251842.1 phage tail terminator-like protein -
OIO62_RS12445 (OIO62_12445) 2621846..2622214 - 369 WP_001983390.1 hypothetical protein -
OIO62_RS12450 (OIO62_12450) 2622180..2622593 - 414 WP_000626004.1 hypothetical protein -
OIO62_RS12455 (OIO62_12455) 2622661..2623323 - 663 WP_001284678.1 hypothetical protein -
OIO62_RS12460 (OIO62_12460) 2623362..2623730 - 369 WP_000524219.1 hypothetical protein -
OIO62_RS12465 (OIO62_12465) 2623730..2624110 - 381 WP_000505832.1 hypothetical protein -

Associated MGEs

MGE
detail		 Similar
MGEs		 Relative
position		 MGE Type Cargo ARG Virulence gene Coordinates Length (bp)


Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.


Domains

Predicted by InterproScan

Toxin

HicA mRNA interferase family

(5-59)

Antitoxin

HicB-like antitoxin of toxin-antitoxin system

(3-126)


Sequences

Toxin        


Download         Length: 61 a.a.        Molecular weight: 6682.88 Da        Isoelectric Point: 10.6602

>T261810 WP_000838147.1 NZ_CP107616:c2619282-2619100 [Acinetobacter baumannii]
VKSLDLIKMIEADGWYEVRVSGSHHHFKHPTKKGLVTIPHPKKDLPSGTVKSILKQAGLK

Download         Length: 183 bp

Antitoxin


Download         Length: 135 a.a.        Molecular weight: 14605.61 Da        Isoelectric Point: 4.4169

>AT261810 WP_000966690.1 NZ_CP107616:c2619035-2618631 [Acinetobacter baumannii]
MLYPIAIERGTDTEAFGVTVPDIPGCFSAGDTLEEAIENVKEAISGHLEILAEDGEEIPLASDLAKFVDDPDYKGMIWAV
TEVDVSRYLGKPEKINVTLPSRLIRKIDENVGKGKRYTTRSAFLAAGAEKLLHA

Download         Length: 405 bp


Similar Proteins

Only experimentally validated proteins are listed.

Protein Organism Identities (%) Coverage (%) Ha-value
Protein Organism Identities (%) Coverage (%) Ha-value

Structures

Toxin

Source ID Structure
AlphaFold DB A0A5Q0RPK1

Antitoxin

Source ID Structure
AlphaFold DB A0A335N5K1

References