Detailed information of TA system
Overview
TA module
| Type | IV | Classification (family/domain) | cptAB/- |
| Location | 464777..465430 | Replicon | chromosome |
| Accession | NZ_CP107616 | ||
| Organism | Acinetobacter baumannii strain 1326932 | ||
Toxin (Protein)
| Gene name | cptA | Uniprot ID | - |
| Locus tag | OIO62_RS02290 | Protein ID | WP_000607096.1 |
| Coordinates | 465041..465430 (+) | Length | 130 a.a. |
Antitoxin (Protein)
| Gene name | cptB | Uniprot ID | V5V966 |
| Locus tag | OIO62_RS02285 | Protein ID | WP_001288210.1 |
| Coordinates | 464777..465034 (+) | Length | 86 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIO62_RS02265 (OIO62_02265) | 460293..461300 | + | 1008 | WP_000198631.1 | DNA-directed RNA polymerase subunit alpha | - |
| OIO62_RS02270 (OIO62_02270) | 461319..461696 | + | 378 | WP_001216380.1 | 50S ribosomal protein L17 | - |
| OIO62_RS02275 (OIO62_02275) | 461878..463368 | + | 1491 | WP_000415137.1 | NAD(P)/FAD-dependent oxidoreductase | - |
| OIO62_RS02280 (OIO62_02280) | 463417..464589 | - | 1173 | WP_001190543.1 | acyl-CoA dehydrogenase family protein | - |
| OIO62_RS02285 (OIO62_02285) | 464777..465034 | + | 258 | WP_001288210.1 | succinate dehydrogenase assembly factor 2 | Antitoxin |
| OIO62_RS02290 (OIO62_02290) | 465041..465430 | + | 390 | WP_000607096.1 | hypothetical protein | Toxin |
| OIO62_RS02295 (OIO62_02295) | 466200..467285 | + | 1086 | WP_000049106.1 | hypothetical protein | - |
| OIO62_RS02300 (OIO62_02300) | 467363..467929 | + | 567 | WP_000651536.1 | rhombosortase | - |
| OIO62_RS02305 (OIO62_02305) | 468117..470312 | + | 2196 | WP_001158905.1 | TRAP transporter large permease subunit | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 130 a.a. Molecular weight: 15583.80 Da Isoelectric Point: 10.4637
>T261808 WP_000607096.1 NZ_CP107616:465041-465430 [Acinetobacter baumannii]
MINHSNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLH
MINHSNFKLKYSRFSIIFQFFIGLSLAVLFYQLMPLLWWLVVISLLFISFIFFLKRPQLAQIAYLDKKLWSLAYHSQNTI
SRVKILKIIDYQIFIVIYFEGHKTLTSIIWFDQMSLAEWKKLKTLEKLH
Download Length: 390 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|