Detailed information of TA system
Overview
TA module
| Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
| Location | 1481..2069 | Replicon | plasmid unnamed1 |
| Accession | NZ_CP107615 | ||
| Organism | Acinetobacter baumannii strain 1326927-2 | ||
Toxin (Protein)
| Gene name | brnT | Uniprot ID | A0A0J8TIH5 |
| Locus tag | OIO47_RS18795 | Protein ID | WP_000438827.1 |
| Coordinates | 1782..2069 (-) | Length | 96 a.a. |
Antitoxin (Protein)
| Gene name | brnA | Uniprot ID | N9M5I3 |
| Locus tag | OIO47_RS18790 | Protein ID | WP_001983304.1 |
| Coordinates | 1481..1795 (-) | Length | 105 a.a. |
Genomic Context
| Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
|---|---|---|---|---|---|---|
| OIO47_RS18790 (OIO47_18790) | 1481..1795 | - | 315 | WP_001983304.1 | BrnA antitoxin family protein | Antitoxin |
| OIO47_RS18795 (OIO47_18795) | 1782..2069 | - | 288 | WP_000438827.1 | BrnT family toxin | Toxin |
| OIO47_RS18800 (OIO47_18800) | 2316..2618 | - | 303 | WP_000702763.1 | hypothetical protein | - |
| OIO47_RS18805 (OIO47_18805) | 2712..2996 | + | 285 | WP_001071102.1 | hypothetical protein | - |
| OIO47_RS18810 (OIO47_18810) | 3011..3505 | - | 495 | WP_000999995.1 | hypothetical protein | - |
| OIO47_RS18815 (OIO47_18815) | 3541..3717 | - | 177 | WP_000246872.1 | hypothetical protein | - |
| OIO47_RS18820 (OIO47_18820) | 3999..4211 | - | 213 | WP_000687427.1 | hypothetical protein | - |
Associated MGEs
| MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
|---|---|---|---|---|---|---|---|
| - | inside | Non-Mobilizable plasmid | - | - | 1..19667 | 19667 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11329.75 Da Isoelectric Point: 5.6762
>T261807 WP_000438827.1 NZ_CP107615:c2069-1782 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRYTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRYTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
| Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
|---|
Structures
Toxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | A0A0J8TIH5 |
Antitoxin
| Source | ID | Structure |
|---|---|---|
| AlphaFold DB | N9M5I3 |