Detailed information of TA system
Bioinformatically predictedOverview
TA module
Type | II | Classification (family/domain) | BrnTA/BrnT-BrnA |
Location | 14035..14623 | Replicon | plasmid unnamed1 |
Accession | NZ_CP107609 | ||
Organism | Acinetobacter baumannii strain 1326924-2 |
Toxin (Protein)
Gene name | brnT | Uniprot ID | A0A0J8TIH5 |
Locus tag | OIO76_RS19175 | Protein ID | WP_000438827.1 |
Coordinates | 14035..14322 (+) | Length | 96 a.a. |
Antitoxin (Protein)
Gene name | brnA | Uniprot ID | N9M5I3 |
Locus tag | OIO76_RS19180 | Protein ID | WP_001983304.1 |
Coordinates | 14309..14623 (+) | Length | 105 a.a. |
Genomic Context
Locus tag | Coordinates | Strand | Size (bp) | Protein ID | Product | Description |
---|---|---|---|---|---|---|
OIO76_RS19150 (OIO76_19155) | 11893..12105 | + | 213 | WP_000687427.1 | hypothetical protein | - |
OIO76_RS19155 (OIO76_19160) | 12387..12563 | + | 177 | WP_000246872.1 | hypothetical protein | - |
OIO76_RS19160 (OIO76_19165) | 12599..13093 | + | 495 | WP_000999995.1 | hypothetical protein | - |
OIO76_RS19165 (OIO76_19170) | 13108..13392 | - | 285 | WP_001071102.1 | hypothetical protein | - |
OIO76_RS19170 (OIO76_19175) | 13486..13788 | + | 303 | WP_000702763.1 | hypothetical protein | - |
OIO76_RS19175 (OIO76_19180) | 14035..14322 | + | 288 | WP_000438827.1 | BrnT family toxin | Toxin |
OIO76_RS19180 (OIO76_19185) | 14309..14623 | + | 315 | WP_001983304.1 | BrnA antitoxin family protein | Antitoxin |
OIO76_RS19185 (OIO76_19190) | 14751..17162 | + | 2412 | WP_000932942.1 | TonB-dependent receptor ZnuD2 | - |
OIO76_RS19190 (OIO76_19195) | 17467..17928 | + | 462 | WP_000761346.1 | DIP1984 family protein | - |
OIO76_RS19195 (OIO76_19200) | 18254..18463 | - | 210 | WP_000069474.1 | hypothetical protein | - |
OIO76_RS19200 (OIO76_19205) | 18456..18758 | - | 303 | WP_001140621.1 | XRE family transcriptional regulator | - |
OIO76_RS19205 (OIO76_19210) | 18751..19107 | - | 357 | WP_000269909.1 | type II toxin-antitoxin system RelE/ParE family toxin | - |
Associated MGEs
MGE detail |
Similar MGEs |
Relative position |
MGE Type | Cargo ARG | Virulence gene | Coordinates | Length (bp) |
---|---|---|---|---|---|---|---|
- | inside | Non-Mobilizable plasmid | - | - | 1..19667 | 19667 |
Relative position:
(1) inside: TA loci is completely located inside the MGE;
(2) overlap: TA loci is partially overlapped with the MGE;
(3) flank: The TA loci is located in the 5 kb flanking regions of MGE.
Sequences
Toxin
Download Length: 96 a.a. Molecular weight: 11329.75 Da Isoelectric Point: 5.6762
>T261800 WP_000438827.1 NZ_CP107609:14035-14322 [Acinetobacter baumannii]
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRYTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
MEQYFEWDEAKNRKNQKKHDISFETASLVFEDPLRISIQDRYTNGEERWQTIGRVKGVLMLLVAHTIFDEDDCEIIRIIS
ARQVTKAERNKYEHG
Download Length: 288 bp
Antitoxin
Similar Proteins
Only experimentally validated proteins are listed.
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Protein | Organism | Identities (%) | Coverage (%) | Ha-value |
---|
Structures
Toxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | A0A0J8TIH5 |
Antitoxin
Source | ID | Structure |
---|---|---|
AlphaFold DB | N9M5I3 |